HP Storage Essentials SRM 6.0 User Guidefor Enterprise Edition and Standard Edition SRM SoftwareSecond edition: July 2008
xManaging Performance Collectors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 217Starting Performance Collect
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries62Discovering Sun StorEdge 3510 Storage SystemsBefore you can discover a Sun Sto
HP Storage Essentials SRM 6.0 User Guide 63• IP address or system name of the controller or proxy you want to discover. • HP SIM does not allow blank
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries64• Discovering HP NAS Devices on Linux, page 64• Discovering NetApp NAS Devices
HP Storage Essentials SRM 6.0 User Guide 656. Change the value to true to enable NAS support, as shown in the following example:nas=true7. Save your c
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries661. Select Options > Storage Essentials > Manage Product Health, and then
HP Storage Essentials SRM 6.0 User Guide 67Discovery Data CollectionIMPORTANT: Access Discovery Data Collection by selecting Options > Storage Esse
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries68• If an element changes and you run Discovery Data Collection while the provid
HP Storage Essentials SRM 6.0 User Guide 692. On the View Logs page, click the Click here portion of the following message:Click here if you wish to s
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries70NOTE: The sample file is located in <HP SIM install directory>/config o
HP Storage Essentials SRM 6.0 User Guide 71Rules for the Inclusive and Exclusive FlagsThe filter file uses inclusive or exclusive flags to indicate in
HP Storage Essentials SRM 6.0 User Guide xiGenerating a Support Database . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries721. Use a text editor to create a file named SEDiscoveryFilterList (with no fil
HP Storage Essentials SRM 6.0 User Guide 73To view HP Storage Essentials progress, open the HP Storage Essentials Log and click Refresh in the next tw
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries744. Select the Systems loaded from the central management server, sorted by opt
HP Storage Essentials SRM 6.0 User Guide 75During these operations, the management server displays its status at regular intervals. To view logs for t
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries76Using Discovery GroupsThe discovery groups feature is sometimes called segment
HP Storage Essentials SRM 6.0 User Guide 77Creating Custom Discovery ListsYou can create a discovery list for Discovery Data Collection, which will al
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries78NOTE: The path to the log file for the discovery group is listed at the top of
HP Storage Essentials SRM 6.0 User Guide 79Deleting Discovered ElementsTo remove a discovered element completely you must delete it from both HP SIM a
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries80If you are blocking pop-ups you must disable the popup blocker before you can
HP Storage Essentials SRM 6.0 User Guide 81The elements you quarantine appear with a flag ( ) in the Quarantined column on the Discovery Data Collecti
xiiChanging the Fabric Name . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 290Deleting Fabrics . . . . . .
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries82For more information, see the following topics: ”Excluding EMC Symmetrix Stora
HP Storage Essentials SRM 6.0 User Guide 833 Discovering Applications, Backup Hosts and HostsHP Storage Essentials Standard Edition supports a subset
Discovering Applications, Backup Hosts and Hosts84service. To determine the Logon account for the DataProtector CRS service, go to Control Panel >
HP Storage Essentials SRM 6.0 User Guide 85Discovery of hosts consists of these steps:• ”Step A — Set Up Discovery for Hosts” on page 85.• ”Step B — D
Discovering Applications, Backup Hosts and Hosts86NOTE: To use a hosts file to specify systems for an automatic discovery, add the hosts file name to
HP Storage Essentials SRM 6.0 User Guide 87NOTE: SE discovery processing might finish before the SE Identification column shows the Running status. Fr
Discovering Applications, Backup Hosts and Hosts88• During Discovery Data Collection the data you see in the user interface is not updated until the d
HP Storage Essentials SRM 6.0 User Guide 89See ”Step 1 — Discovering Your Hosts and Backup Manager Hosts” on page 83, then set up the configurations f
Discovering Applications, Backup Hosts and Hosts901. Select Discovery > Setup.2. Click the Applications tab.3. Click Change Password in the Change
HP Storage Essentials SRM 6.0 User Guide 91• Verify that the instance TNS (Transparent Name Substrate) listener is running so that the management serv
HP Storage Essentials SRM 6.0 User Guide xiiiDetermining If a Host Belongs to a File System . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Discovering Applications, Backup Hosts and Hosts92NOTE: You can use a remote Oracle client to run this script. 4. Specify the Oracle instance name, wh
HP Storage Essentials SRM 6.0 User Guide 932. If you plan to remove the management software for Oracle from a computer running Windows, go to the \DBI
Discovering Applications, Backup Hosts and Hosts94IMPORTANT: Monitoring Oracle 10g or Oracle clusters requires an additional step. If you are not moni
HP Storage Essentials SRM 6.0 User Guide 95The port can be found in the following code:LISTENER = (DESCRIPTION_LIST = (DESCRIPTION = (ADDRESS
Discovering Applications, Backup Hosts and Hosts961. Install the CIM extension on each node in the cluster.2. Create the APPIQ_USER account for the Or
HP Storage Essentials SRM 6.0 User Guide 97Discovery of Oracle RAC Instances Using One InstanceBecause one RAC instance can provide information for th
Discovering Applications, Backup Hosts and Hosts98b. Click the Create button for the Database Information table.c. In the Host IP/DNS Name box, enter
HP Storage Essentials SRM 6.0 User Guide 99return identical capacity data). However, the management server does not explicitly identify and construct
Discovering Applications, Backup Hosts and Hosts100of the monitored database. Do not look for the listener.ora file on the management server for this
HP Storage Essentials SRM 6.0 User Guide 101• ”Step B — Provide the Microsoft SQL Server Name and Port Number” on page 104IMPORTANT: Make sure the Mic
xivSeverity Levels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 373Creating a Uti
Discovering Applications, Backup Hosts and Hosts102The management server accesses Microsoft SQL Server through the appiq_user account. This account is
HP Storage Essentials SRM 6.0 User Guide 103criteria described in ”Creating Custom Passwords on Managed Database Instances” on page 88. If you are run
Discovering Applications, Backup Hosts and Hosts104You are prompted for the password for this user account when you run the script.3. In a new command
HP Storage Essentials SRM 6.0 User Guide 105IMPORTANT: If you have name resolutions issues, your server may be discovered; however, your applications
Discovering Applications, Backup Hosts and Hosts106Microsoft SQL Server 2000a. Open SQL Server Enterprise Manager. b. Expand the user interface for SQ
HP Storage Essentials SRM 6.0 User Guide 107The account for appiq_user is removed. The management server can no longer monitor the SQL Server database
Discovering Applications, Backup Hosts and Hosts108• Host IP/DNS Name: <IP Address>• Database Server: <SQL Server Name>• Port Number: <
HP Storage Essentials SRM 6.0 User Guide 109a. Open SQL Server Enterprise Manager. b. Expand the user interface for SQL Server Enterprise Manager, and
Discovering Applications, Backup Hosts and Hosts110NOTE: To create the APPIQ_USER with a custom password, run CreateSybaseActCustomPwd.bat. For more i
HP Storage Essentials SRM 6.0 User Guide 111Removing the APPIQ_USER Account for SybaseIMPORTANT: Before you remove the APPIQ_USER account for the Syba
HP Storage Essentials SRM 6.0 User Guide xv14Running Reports . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Discovering Applications, Backup Hosts and Hosts1125. In the Server Name box, enter the Sybase database you want to monitor.6. In the Port Number box,
HP Storage Essentials SRM 6.0 User Guide 113• The user name you provide could be either the Windows logon name or Common Name (CN) of the Active Direc
Discovering Applications, Backup Hosts and Hosts114Click OK.Deleting a Microsoft Exchange Domain ControllerTo delete all of the domain controllers of
HP Storage Essentials SRM 6.0 User Guide 115NOTE: The required drivers for Caché were automatically installed along with the management server.IMPORTA
Discovering Applications, Backup Hosts and Hosts116• On IBM AIX, Linux, or HP-UX, log into an account that has administrative privileges, and mount th
HP Storage Essentials SRM 6.0 User Guide 117Figure 15 Selecting appiq.clsFor Caché 5.2 and Caché 2007.11. Launch the Caché System Management Portal by
Discovering Applications, Backup Hosts and Hosts118where DKA0 is a local drive on the OpenVMS host. c. Browse to $DKA0 and specify SQLPROJS.XML within
HP Storage Essentials SRM 6.0 User Guide 119NOTE: If you are running Caché 5.2 or later, and the Caché instance was installed using “Locked Down” secu
Discovering Applications, Backup Hosts and Hosts120enter the custom password as the fourth argument. When invoking the scripts on OpenVMS, enclose the
HP Storage Essentials SRM 6.0 User Guide 121For Caché 5.2 and later versions, if the Caché instance was installed using “Locked Down” security mode, e
xviModifying a Zone Alias . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 525Deleting a Zone Alias
Discovering Applications, Backup Hosts and Hosts1224. Enter the Caché server name, the Super Server port number and the password of the _SYSTEM user a
HP Storage Essentials SRM 6.0 User Guide 1238. Click OK.IMPORTANT: Perform Discovery Data Collection for your inputs to take effect. See ”Step 3 — Dis
Discovering Applications, Backup Hosts and Hosts1242. To start discovering elements on the network, click the Start Discovery button on the IP Address
HP Storage Essentials SRM 6.0 User Guide 125Step C — Run Discovery Data CollectionObtain detailed information from the discovered applications as desc
Discovering Applications, Backup Hosts and Hosts126IMPORTANT: If the management server cannot communicate with an application, it labels the applicati
HP Storage Essentials SRM 6.0 User Guide 127The management server requires the password to have the following characteristics:• a minimum of three cha
Discovering Applications, Backup Hosts and Hosts128
HP Storage Essentials SRM 6.0 User Guide 1294 Host and Application ClusteringSome of the features described in this chapter are not included in HP Sto
Host and Application Clustering130For information about discovering application clusters, see ”Discovering Applications, Backup Hosts and Hosts” on pa
HP Storage Essentials SRM 6.0 User Guide 1313. Cluster Manager Step 2 (Specify Cluster Properties and Cluster Members) is displayed. If you are discov
HP Storage Essentials SRM 6.0 User Guide xviiHost Security Groups on EMC CLARiiON and Sun 6130 Storage Systems . . . . . . . . . 553Host Security Gr
Host and Application Clustering132Filtering HostsThe Available Hosts table on Cluster Manager Step 2 (Specify Cluster Properties and Cluster Members)
HP Storage Essentials SRM 6.0 User Guide 133Clustering in System ManagerSystem Manager has been enhanced to seamlessly support clusters in all areas.
Host and Application Clustering134Double-click a cluster to open the Properties page for the cluster. Double-click an individual cluster node to open
HP Storage Essentials SRM 6.0 User Guide 135In the following figure, individual instances of Microsoft Exchange Server 2003 share HP EVA virtual disk
Host and Application Clustering136• Whole cluster capacity• Individual application instance capacity• Individual cluster node capacity• Capacity trend
HP Storage Essentials SRM 6.0 User Guide 1375 Managing SecurityIMPORTANT: Depending on your license, role-based security may not be available. See the
Managing Security138IMPORTANT: These roles apply only to features and elements in HP Storage Essentials. For example, assume you assigned a user to th
HP Storage Essentials SRM 6.0 User Guide 139SIMViewOnlyUsers created in HP Systems Insight Manager are automatically placed in the SIMViewOnly role. T
Managing Security140Options for Restricting a RoleIn addition, you can assign one of the following options within a role to further allow or restrict
HP Storage Essentials SRM 6.0 User Guide 141Users assigned to an organization can see only the elements that belong to that organization. If users are
xviiiDetermining if the Last Scheduled Backup was Successful . . . . . . . . . . . . . . . . . . . . . . . . . . . . 575Viewing the Summary Backup
Managing Security142• NYWebHost_Solaris• NYWebHosts• WebHosts• US East CoastFigure 21 Children in Multiple OrganizationsWhen you remove an element fro
HP Storage Essentials SRM 6.0 User Guide 143report. This is also true when you email reports. If you do not have permission to access hosts, the repor
Managing Security144• Viewing the Properties of an Organization, page 148Adding UsersThis section contains procedures for adding users and authorizing
HP Storage Essentials SRM 6.0 User Guide 145The users you created in HP SIM are put in the SIMViewOnly Role. This role does not allow users to access
Managing Security146NOTE: The Everything organization is the default organization that lets users access all current and future elements.11.Click OK.
HP Storage Essentials SRM 6.0 User Guide 1473. When you are done with your modifications, click Save Changes.Modifying Your User PreferencesUse the Us
Managing Security148• Role Description — A description of the role. • Access Level — How much access the user has to a type of element, such as hosts,
HP Storage Essentials SRM 6.0 User Guide 149• The Role Name and Description boxes do not accept special characters, except spaces and the following ch
Managing Security1501. Access Storage Essentials through one of the menu options, such as Options > Storage Essentials > Email Settings.2. In th
HP Storage Essentials SRM 6.0 User Guide 151• Removing Members from an Organization, page 154• Filtering Organizations, page 154Adding an Organization
HP Storage Essentials SRM 6.0 User Guide xixLUN Security and Zone Operation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Managing Security152b. In the right-hand pane, select the elements you would like to add by clicking the appropriate check boxes.c. Click Add. d. The
HP Storage Essentials SRM 6.0 User Guide 153To access information about a child organization, click its link in the Child Organization column.Editing
Managing Security154organization, you will still have access to hosts because you still belong to the onlyHosts organization.Keep in mind the followin
HP Storage Essentials SRM 6.0 User Guide 155• Users assigned to the Admin account cannot filter organizations because the Admin account belongs to the
Managing Security156• DB_SYSTEM_USER — Used for all the database activity, including establishing a connection to the management server database. Defa
HP Storage Essentials SRM 6.0 User Guide 1575. Enter the current password in the Old Password box.6. Enter the new password in the New Password box.7.
Managing Security158Configuring the Management Server to Use Active DirectoryBy default, AD allows connections with domain\username, instead of with t
HP Storage Essentials SRM 6.0 User Guide 1596. Replace directory2.hp.com with the IP address or the fully qualified DNS name of your secondary Domain
Managing Security160<ActiveDirectory><PrimaryServer port="389">IP address of Primary Domain Controller</PrimaryServer><
HP Storage Essentials SRM 6.0 User Guide 161</LDAP></LoginHandler>When you are done with your changes, the login-handler.xml file, may res
Legal and notice information© Copyright 2002-2008 Hewlett-Packard Development Company, L.P.Hewlett-Packard Company makes no warranty of any kind with
xxAdding Asset Information . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 645Adding General Informa
Managing Security1622. In the login-handler.xml file, comment out the section that contains com.appiq.security.server.BasicLoginhandler, which enables
HP Storage Essentials SRM 6.0 User Guide 163<SearchBase>CN=$NAME$,OU=NetworkAdministration, dc=MyCompanyName,ou=US,dc=COM</SearchBase>The
Managing Security164<ssl>false</ssl><ShadowPassword>false</ShadowPassword><CaseSensitiveUserName>false</CaseSensitive
HP Storage Essentials SRM 6.0 User Guide 165b. Enter the following at the command prompt to stop the management server:/etc/init.d/appstormanager stop
Managing Security166
HP Storage Essentials SRM 6.0 User Guide 1676 Managing LicensesSome of the features described in this chapter are not included in HP Storage Essential
Managing Licenses168Backup Size The management server determines licensing for Backup Manager through gigabytes (GB). The management server compares t
HP Storage Essentials SRM 6.0 User Guide 169IMPORTANT: The management server Current Usage Summary is first updated six hours after the management ser
Managing Licenses170Example 1: Assume you have the following environment:• Brocade (two switches of 12 ports each, one switch of 16 ports) — Total 40
HP Storage Essentials SRM 6.0 User Guide 171Assume you have the same configuration as the first example, with two Windows 2000 hosts that are directly
HP Storage Essentials SRM 6.0 User Guide xxiFiltering Assets by Status . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Managing Licenses172To import a license file, 1. Select Deploy > Storage Essentials > License Manager > Manage Storage Essentials Keys in HP
HP Storage Essentials SRM 6.0 User Guide 173The license’s name and file name are listed, along with its properties. You can determine how many MAPs an
Managing Licenses174IMPORTANT: You must complete a Discovery Data Collection for the EVA arrays before importing the license and starting the collecto
HP Storage Essentials SRM 6.0 User Guide 175Select Enhanced Performance Collection Enabling to select the EVA arrays you want to include for enhanced
Managing Licenses1762. Go to the Webware Licensing website to use the HP Password Delivery Service, and redeem the license key for your product order.
HP Storage Essentials SRM 6.0 User Guide 1777 Configuring the Management ServerSome of the features described in this chapter aren’t included in HP St
Configuring the Management Server178The software does receive SNMP traps from some devices. These traps are translated into events in Event Manager. W
HP Storage Essentials SRM 6.0 User Guide 1793. Required: In the Name box, enter the DNS name or the IP address of the Simple Mail Transfer Protocol (S
Configuring the Management Server180• Paper height - Displays the height of the paper. You can modify the measurement in this field when you select th
HP Storage Essentials SRM 6.0 User Guide 181• Width - Determines the width of the printout. If the width entered does not fit on the page, the printou
xxii Linux . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 700Troubleshooting
Configuring the Management Server182• Include backup details - To obtain the latest backup information, select the Include backup details option, and
HP Storage Essentials SRM 6.0 User Guide 183• Include backup details - To obtain the latest backup information, select the Include backup details opti
Configuring the Management Server184Editing a ScheduleTo edit a schedule:1. Select Options > Storage Essentials > Discovery > Schedule Discov
HP Storage Essentials SRM 6.0 User Guide 185To apply the filter settings, click Filter to refresh the content of the page. To restore the filters to t
Configuring the Management Server186• Database alert log - The Database Alert Log scans the management server for critical errors at a specified inter
HP Storage Essentials SRM 6.0 User Guide 1871. Select Options > Storage Essentials > Manage Product Health in HP Systems Insight Manager.2. Sele
Configuring the Management Server188• Accessing the Log Files, page 188• Downloading Logs to a File Using the Download Logs Feature, page 190• Downloa
HP Storage Essentials SRM 6.0 User Guide 189Log file timestamp - A timestamp (YYMMDD-HHMMSS) is inserted into the filename at its creation, making its
Configuring the Management Server190Adding trace for XML received from CIMOM - Traces are normally very large files. For that reason, the trace is tur
HP Storage Essentials SRM 6.0 User Guide 191NOTE: The Log Download Utility does not trigger CIMOM thread dumps, Environment variable dumps, Port usage
HP Storage Essentials SRM 6.0 User Guide xxiiiERROR replicating APPIQ_EVAStorageVolume during Discovery Data Collection for an EVA array. 719Recalcu
Configuring the Management Server192Downloading the Discovery Summary LogYou can view status information from Discovery Data Collection by viewing the
HP Storage Essentials SRM 6.0 User Guide 193Use the table ”Logging Levels” on page 192 as a guideline for the different options. Several of the option
Configuring the Management Server194Enabling the Scanning of Critical Events of the Management Server DatabaseYou can configure the management server
HP Storage Essentials SRM 6.0 User Guide 195Controlling the Display of Cleared and Deleted EventsYou can control how the management server displays ev
Configuring the Management Server196Configuring the Clearing of EventsDepending on the severity of an event, the management server may mark the event
HP Storage Essentials SRM 6.0 User Guide 197To change the default time delay to delete an event:1. Select Options > Events > Storage Essentials
Configuring the Management Server198• Next Scheduled Run - Displays the next time the management server is scheduled to obtain image details from the
HP Storage Essentials SRM 6.0 User Guide 1995. Set the date, time, and repeat interval for this task. For more information, see ”Setting the Date and
Configuring the Management Server200• Interval (Minutes) - Displays how often the management server is scheduled to obtain drive monitoring details.•
HP Storage Essentials SRM 6.0 User Guide 201views are refreshed, as described in ”Refreshing the Report Cache” on page 208. The overall report archite
xxivZ. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 734Index . . . . . . . . . .
Configuring the Management Server202Report Refresh StatusThe management server has two types of views for its reports. During a report cache refresh,
HP Storage Essentials SRM 6.0 User Guide 2036. Enter the following at the command prompt:order by 2;Managing Collectors for ReportsThe management serv
Configuring the Management Server204Starting CollectorsIMPORTANT: After you click OK, if the date and time you set has not passed, the collector start
HP Storage Essentials SRM 6.0 User Guide 2053. Set the date, time, and repeat interval for this task. For more information, see ”Editing a Collector S
Configuring the Management Server206Editing E-mail Schedules for ReportsIMPORTANT: Schedule your reports to be sent soon after a report cache refresh.
HP Storage Essentials SRM 6.0 User Guide 207If you are e-mailing reports in bulk, you might want to let users know the e-mail is being sent by an auto
Configuring the Management Server208IMPORTANT: Perform the following steps only if customer support has instructed you to modify one of the collectors
HP Storage Essentials SRM 6.0 User Guide 209Keep in mind the following:• If Discovery Data Collection is occurring, wait for it to finish before click
Configuring the Management Server210When you set up Global Reporter, the management server pulls the data from the local database views at these sites
HP Storage Essentials SRM 6.0 User Guide 211Keep in mind the following when setting up global reporting:• Multiple Global Reporter Servers - Global re
HP Storage Essentials SRM 6.0 User Guide xxvFigures1 Accessing Features from the Tools > Storage Essentials Menu . . . . . . . . . . . . . . . . .
Configuring the Management Server212• Unable to Contact Site - If the management server is unable to contact one of the sites in the Global Reporting
HP Storage Essentials SRM 6.0 User Guide 213Keep in mind the following:• The remote site is not required to have global reporting enabled in its licen
Configuring the Management Server2144. Modify the following information for your remote servers that are running the management server:• IP Address -
HP Storage Essentials SRM 6.0 User Guide 215Now, let's assume you removed remotesiteA from the user interface by clicking the corresponding but
Configuring the Management Server216The instructions also remind you to refer to Help for additional information.After you package the necessary files
HP Storage Essentials SRM 6.0 User Guide 217Deleting Custom ReportsIf you want to delete imported custom reports by clicking Delete, the system displa
Configuring the Management Server218To apply the filter settings, click Filter to refresh the content of the Report Data Collector page. To restore th
HP Storage Essentials SRM 6.0 User Guide 219Starting Performance CollectorsTo start a collector:1. Access the page for performance collectors (Optimiz
Configuring the Management Server220The collector stops gathering information for its corresponding reports.To stop more than one collector at once, s
HP Storage Essentials SRM 6.0 User Guide 221Editing the Locale and Currency SettingsThe management server determines which languages and currency to d
xxvi47 Enclosing the Elements . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27548 Dragging Mul
Configuring the Management Server222IMPORTANT: You must restart the management server for your changes to take effect.Process NamesThis section descri
HP Storage Essentials SRM 6.0 User Guide 223NOTE: If you are using the prstat utility, all of the processes will be named java.exe.Editing a Collector
Configuring the Management Server224
HP Storage Essentials SRM 6.0 User Guide 2258 Database Maintenance and ManagementThis chapter contains information about backing up and restoring the
Database Maintenance and Management226NOTE: The archive directory (\oracle\oradata\APPIQ\archive on Microsoft Windows and $ORACLE_HOME/oradata/APPIQ/a
HP Storage Essentials SRM 6.0 User Guide 227IMPORTANT: Export and RMAN backups should be done regularly and in combination. Backup Destination and O
Database Maintenance and Management228The scheduled backup writes in the backup1 and backup2 folders, in rotation. The Backup Now backup from the mana
HP Storage Essentials SRM 6.0 User Guide 229• If the database fails as a result of a corrupt data file, the database can only be restored to the last
Database Maintenance and Management230Keep in mind the following:• Only one user at a time can back up the database.• The management server archives f
HP Storage Essentials SRM 6.0 User Guide 231Performing an RMAN Hot BackupYou can perform an RMAN hot backup instantly. The backup is referred to as be
HP Storage Essentials SRM 6.0 User Guide xxvii94 Report Architecture . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Database Maintenance and Management2321. Verify that you have enabled database archive mode and RMAN backup as described in ”Changing the Archive Mode
HP Storage Essentials SRM 6.0 User Guide 2331. Click Options > Storage Essentials > Manage Product Health in HP Systems Insight Manager.2. Selec
Database Maintenance and Management2342. Access the database utility by doing the following on the management server:•On Linux:a. Set the display if y
HP Storage Essentials SRM 6.0 User Guide 235IMPORTANT: Do not use the Oracle tools to change the passwords.• SYS - Used for the management server data
Database Maintenance and Management236d. Stop the HP Systems Insight Manager service so that it cannot access the database. It is very important that
HP Storage Essentials SRM 6.0 User Guide 237save you time with exporting the database if your database includes a large amount of report data.7. Click
Database Maintenance and Management238Re-initializing the DatabaseCAUTION: Do not use the Database Admin Utility to re-initialize the HP SIM database.
HP Storage Essentials SRM 6.0 User Guide 239c. Type the password of the SYSTEM account. Then, click OK. The default password of the SYSTEM account is
Database Maintenance and Management240RMAN Backup. The backup is referred to as being “cold” because the management server is not running while the ba
HP Storage Essentials SRM 6.0 User Guide 241•The Disable RMAN backup button is displayed if the archive mode is currently enabled. Select this option
xxvi-ii
Database Maintenance and Management242• Management server RMAN backup files —These files contain information about the elements your management server
HP Storage Essentials SRM 6.0 User Guide 2431. Access the Database Admin Utility as described in ”Accessing the Database Admin Utility” on page 233.2.
Database Maintenance and Management244Warning Messages During Reinitializing the DatabaseWhen you use the Database Admin Utility to re-initialize the
HP Storage Essentials SRM 6.0 User Guide 245For example, if the management server is managing two Oracle and two Sybase database applications, ask the
Database Maintenance and Management246• Only the admin user will be able to log into the management server, no other user will be able to log in to th
HP Storage Essentials SRM 6.0 User Guide 247• From the Database Admin Utility. See ”Checking the Database and Listener Status” on page 234. Checking D
Database Maintenance and Management248
HP Storage Essentials SRM 6.0 User Guide 2499 Viewing Element Topology and PropertiesSome of the features described in this chapter are not included i
Viewing Element Topology and Properties250NOTE: To view direct-attached storage, you must enable the button. See Table 29 on page 253 for more infor
HP Storage Essentials SRM 6.0 User Guide 251• Navigation - The Navigation tab provides information about an element and how it relates to other elemen
HP Storage Essentials SRM 6.0 User Guide xxixTables1 Document conventions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Viewing Element Topology and Properties252belong to the same fabric. The management server displays switch_A and switch_B under the same fabric withou
HP Storage Essentials SRM 6.0 User Guide 253Table 29 Feature of the Toolbar in System ManagerButton DescriptionPrints the topology. See ”Printing the
Viewing Element Topology and Properties254Saves the current topology, so that when you return to System Manager, the saved layout is restored. This op
HP Storage Essentials SRM 6.0 User Guide 255Icons Displayed in the TopologyTable 30 on page 255 provides a brief description of the icons displayed in
Viewing Element Topology and Properties256The List TabThe List tab provides information about the elements by type, by cluster, or by fabric and domai
HP Storage Essentials SRM 6.0 User Guide 257When you click a fabric name in the tree, its members are highlighted in the right pane, as shown in the f
Viewing Element Topology and Properties258Applications node, the applications are highlighted in the topology, as shown in the following figure.Figure
HP Storage Essentials SRM 6.0 User Guide 259Obtaining Information About Zone EntriesTo view the zone entries in a domain, expand the tree for the doma
Viewing Element Topology and Properties260• Click the node of the zone in the tree. The software highlights the zone members in the right pane.Figure
HP Storage Essentials SRM 6.0 User Guide 261To view information about a zone member's port, expand the zone member node, as shown in the followin
HP Storage Essentials SRM 6.0 User Guide iiiContentsAbout this Guide . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
xxx47 Supported Hardware for Events. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33248 Default Settings for Clea
Viewing Element Topology and Properties262When you click the HBA node, the host and the element to which it has the binding are highlighted. A green l
HP Storage Essentials SRM 6.0 User Guide 263displayed under the node, and the storage system is highlighted in the right pane, as shown in the followi
Viewing Element Topology and Properties264When you expand a domain node, if any of the paths for hosts are not fully calculated, a pop-up dialog box d
HP Storage Essentials SRM 6.0 User Guide 265You can also determine the elements in a hosts path by expanding the Application Path and Path nodes under
Viewing Element Topology and Properties266NOTE: Right-click menu options are not available to undiscovered fabrics.Table 31 Menu Options Accessible fr
HP Storage Essentials SRM 6.0 User Guide 267External Tools Provides several ways to access an element:• Telnet - Lets you access a host or a switch th
Viewing Element Topology and Properties268Provision Provides provisioning tools for switches and storage systems:Switches - Lets you activate and deac
HP Storage Essentials SRM 6.0 User Guide 269* Additional menu items may appear for types of automators and advisors, such as Reachable Storage. The de
Viewing Element Topology and Properties270your kit. To determine if you can access Provisioning Manager, access the List of Features, which is accessi
HP Storage Essentials SRM 6.0 User Guide 2711When McDATA and Connectrix switches are discovered through a proxy by SNMP, you cannot view or perform an
HP Storage Essentials SRM 6.0 User Guide xxxi94 MVCA_VIRTUALAPPCAPACITYVW . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Viewing Element Topology and Properties272• Using the Global View, page 276• Printing the Topology, page 276• Exporting the Topology to Microsoft Visi
HP Storage Essentials SRM 6.0 User Guide 273Adding Information for Discovered HostsThe software labels a host as discovered when it cannot obtain addi
Viewing Element Topology and Properties274Arranging Elements in the TopologyTo improve usability, arrange the topology so it suits your environment. F
HP Storage Essentials SRM 6.0 User Guide 275A square encloses the elements, as shown in the following figure. If you want to redo the square, just cli
Viewing Element Topology and Properties276Closing Topology WindowsWhenever you select a new topology view, the software creates a pane for that view.
HP Storage Essentials SRM 6.0 User Guide 277• Bottom margin - Enter a measurement.• Left margin - Enter a measurement.• Right margin - Enter a measure
Viewing Element Topology and Properties27810.To preview your pages, click the Preview tab. Then click the page you want to preview.The page appears in
HP Storage Essentials SRM 6.0 User Guide 2792. Click Next. The Select Destination Location windows is displayed. 3. Click Next.The Select Components w
Viewing Element Topology and Properties28012.Click OK.13.Restart Visio, and select Enable Macros when prompted.NOTE: If the Storage Planner menu item
HP Storage Essentials SRM 6.0 User Guide 281• Right-click an element, and then select Show Element Topology from the menu.2. Right-click an element in
xxxii141 Right-Click Menu Options on the Topology Tab . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 583142 Right-Click Menu Options on th
Viewing Element Topology and Properties282in yellow. This means that if any of these highlighted elements are removed from the network, klu2e may have
HP Storage Essentials SRM 6.0 User Guide 283Assigning a Business Cost to an ApplicationThe management server lets you assign a business cost to an app
Viewing Element Topology and Properties284example, a storage system has a value of $60 if two $30 applications are in its path, as shown in the follow
HP Storage Essentials SRM 6.0 User Guide 285Expanding the Topology PaneTo increase screen space for viewing the topology, hide the List, Access, and P
Viewing Element Topology and Properties286NOTE: The Event Status button ( ) is disabled in Capacity Manager and Performance Manager.The icon correspon
HP Storage Essentials SRM 6.0 User Guide 287Since the severity level for an element is set by the manufacturer, the meanings of the severity levels va
Viewing Element Topology and Properties288• Do not create groups during Get Topology or Discovery Data Collection. You can determine if the management
HP Storage Essentials SRM 6.0 User Guide 289• A user's role must include an access level of Element Control or Full Control for hosts. See the to
Viewing Element Topology and Properties290• Connected Switches - To sort storage systems by connected switches, click the Connected Switches column he
HP Storage Essentials SRM 6.0 User Guide 2914. Select Change Fabric Name from the menu.5. In the Enter a Fabric Name box, enter a new fabric name.6. C
HP Storage Essentials SRM 6.0 User Guide xxxiii
Viewing Element Topology and Properties292The management server provides two variations of this feature:• Hiding Generic Hosts for One Switch: This fe
HP Storage Essentials SRM 6.0 User Guide 293Expanding Generic Hosts for All SwitchesTo display hidden generic hosts for a domain:1. Right-click a swit
Viewing Element Topology and Properties294If you want a Perl script to run as a custom command on Microsoft Windows, you must prefix the script name w
HP Storage Essentials SRM 6.0 User Guide 295If the file is missing, repeat step 3.8. Select one of the following options to determine the elements for
Viewing Element Topology and Properties296Editing a Custom CommandTo edit a custom command:1. Right-click an element in System Manager.2. Select Custo
HP Storage Essentials SRM 6.0 User Guide 297Table 36 on page 296 lists variables that can be used to gather information for storage systems, switches,
Viewing Element Topology and Properties298Table 39 on page 297 lists variables that can be used to gather information for applications. Use the variab
HP Storage Essentials SRM 6.0 User Guide 299Using the Remote ConsoleThis section contains the following topics:• About the Remote Console, page 298• K
Viewing Element Topology and Properties300example, you can use the remote console to start a remote command prompt on the management server. Figure 53
HP Storage Essentials SRM 6.0 User Guide 3016. In the Command Line box, enter the following command, which will run on the management server:cmd /k7.
Viewing Element Topology and Properties302Menu OptionsThe remote console also provides the following menu options.Copying Text from the Remote Console
HP Storage Essentials SRM 6.0 User Guide 303• Set up external tools - Lets you add a URL for accessing management software, such as Hitachi HiCommand
Viewing Element Topology and Properties304• If you see a message that zone aliases are not supported on a Brocade switch, perform Discovery Data Colle
HP Storage Essentials SRM 6.0 User Guide 305in the page. You are shown information about the dependent hosts, as shown in the following figure:Figure
Viewing Element Topology and Properties306*The management server displays cxfs for SGI IRIX computers if it detects CXFS on the cluster. On individual
HP Storage Essentials SRM 6.0 User Guide 3073. Click the Ports button in the Physical column in the Navigation tab, as shown in the following figure.F
Viewing Element Topology and Properties308Accessing the Navigation TabTo access the Navigation tab:1. Access the management server. 2. To access the N
HP Storage Essentials SRM 6.0 User Guide 309• Version (Generic Hosts Only) - Enter a version number for a generic host.• Operating System (Generic Hos
Viewing Element Topology and Properties310You can view the following properties of a fabric: • Vendor - The vendor name. • Created - The first time th
HP Storage Essentials SRM 6.0 User Guide 311IMPORTANT: Do not update element data during Get Topology or Discovery Data Collection. You can determine
HP Storage Essentials SRM 6.0 User Guide xxxvAbout this GuideThis guide provides information about:• Discovering elements• Managing Security • Configu
Viewing Element Topology and Properties312in the following figure. According to the following figure, the server can access three storage systems: LSI
HP Storage Essentials SRM 6.0 User Guide 313The topology extends the length of the screen. The second portion of the topology is provided by the follo
Viewing Element Topology and Properties314access a storage system. Another is providing redundant paths from the host to the switch. To determine if y
HP Storage Essentials SRM 6.0 User Guide 315Figure 59 Multipathing Displayed in the TopologyThe topology extends the length of the screen. The followi
Viewing Element Topology and Properties316Figure 60 Multipathing Displayed in the Topology (Continued)Keep in mind the following:• If you do not see a
HP Storage Essentials SRM 6.0 User Guide 317Once the button is enabled, the management server displays the link between the storage system port and
Viewing Element Topology and Properties318Table 44 The Toolbar in the Topology TabIcon DescriptionPrints the topology. See ”Printing the Topology” on
HP Storage Essentials SRM 6.0 User Guide 319About the New Window OptionThe New Window option in System Manager lets you view several sections of the t
Viewing Element Topology and Properties320to move. Drag the element to its new location. Moving elements closer together provides a more compact print
HP Storage Essentials SRM 6.0 User Guide 321IMPORTANT: Before you change the margins, decide on a unit of measurement.• Unit - Select cm (centimeters)
xxxviDocument Conventions and SymbolsWARNING! Indicates that failure to follow directions could result in bodily harm or death.CAUTION: Indicates that
Viewing Element Topology and Properties322• Description• Vendor• Version5. Click Next.6. Select a storage volume containing the application for which
HP Storage Essentials SRM 6.0 User Guide 323• Severity - The severity level• Time - The time the event was recorded.• Summary Text - A brief explanati
Viewing Element Topology and Properties324• ”Adding Custom Information” on page 647Figure 63 Viewing Asset RecordsTo set up chargeback, expand the Cha
HP Storage Essentials SRM 6.0 User Guide 325• Asset Tag - The asset tag assigned to the element.• Asset Category - The asset category assigned to the
Viewing Element Topology and Properties326About the Policies TabThe Policies tab lets you view the utilization policies for an element. Utilization po
HP Storage Essentials SRM 6.0 User Guide 327If a storage volume is a member of a shared file system, such as CXFS or XFS, it is listed in the Storage
Viewing Element Topology and Properties328
HP Storage Essentials SRM 6.0 User Guide 32910 Event ManagementHP Storage Essentials Standard Edition supports a subset of the devices supported by En
Event Management330• Clear Selected - Marks the selected events as cleared.• Clear All - Marks all events as cleared.• Un-clear Selected - Removes the
HP Storage Essentials SRM 6.0 User Guide 331Accessing Event ManagerTo access Event Manager, do one of the following:• To view events from all elements
HP Storage Essentials SRM 6.0 User Guide xxxviiTIP: Provides helpful hints and shortcuts.HP Technical SupportTelephone numbers for worldwide technical
Event Management332Event Manager IconsThe following icons are displayed in Event Manager.Events SupportedEvent Manager does not support events from al
HP Storage Essentials SRM 6.0 User Guide 333McDATA switches SNMP to switchesY Need to configure the switch or proxy to send traps to the management se
Event Management334Viewing Events from the Management ServerBy default the management server displays events from all of the elements, regardless of t
HP Storage Essentials SRM 6.0 User Guide 335Event Manager displays events it receives from CNT InVsn Enterprise Manager. As of version 9.5, InVsn Ente
Event Management3362. In Event Manager click the event summary, as shown in the following figure.Figure 67 Accessing Event DetailsThe event details ar
HP Storage Essentials SRM 6.0 User Guide 337NOTE: Events listed in Event Manager may not be attributed to the correct source until Discovery Data Coll
Event Management338To change the default time delay before clearing an event, do the following:1. Select Configuration > Events to access the Event
HP Storage Essentials SRM 6.0 User Guide 339For example, if you want events that are a week old deleted, select Weeks in the combo box in the Automati
Event Management3404. Click Add Journal Entry.The entry is added with the user's account name and the date and time it was added.Changing the CLA
HP Storage Essentials SRM 6.0 User Guide 341Brocade Switch EventsWhen a Brocade switch generates an event, it assigns a code instead of an event sever
xxxviii
Event Management342*This term does not appear in the event description, but is provided for clarity. Supported Brocade EventsThe Event Manager display
HP Storage Essentials SRM 6.0 User Guide 343• Cleared status• Specific elementTo set up a filter:1. To access the filter for Event Manager, click the
Event Management344• Minor - Only events of the severity type, minor, are displayed.• Major - Only events of the severity type, major, are displayed.•
HP Storage Essentials SRM 6.0 User Guide 345•30 seconds•1 minute•5 minutes•10 minutes10.When you are done setting your options, click the Filter butto
Event Management346b. In the Calendar, select the start date. Figure 74 Selecting a datec. In the Time field, enter the start time. The time is based
HP Storage Essentials SRM 6.0 User Guide 347b. In the Calendar, select the end date. Figure 75 Selecting a datec. In the Time field, enter the end tim
Event Management348The filtering feature is displayed, as shown in the following figure:Figure 77 The Filter feature in Event Manager2. Click the Rese
HP Storage Essentials SRM 6.0 User Guide 349IMPORTANT: Once the Advanced Options heading has been expanded, the Element Name Contains field becomes in
Event Management350For example, in the following figure Host_13081 and Host_10380 were selected for advanced filtering, so they are listed under the A
HP Storage Essentials SRM 6.0 User Guide 351Clearing Advance Filtering OptionsYou can clear the filtering set for advanced options, by clicking the Cl
HP Storage Essentials SRM 6.0 User Guide 11OverviewThis chapter contains the following topics:• About This Product, page 1• Standard Edition and Enter
Event Management3525. To filter events by severity, use the <event-filter-severity> tag. For example, to prevent informational events from being
HP Storage Essentials SRM 6.0 User Guide 353
Event Management354
HP Storage Essentials SRM 6.0 User Guide 35511 Finding an Element’s Storage CapacityIMPORTANT: Depending on your license, Capacity Manager may not be
Finding an Element’s Storage Capacity356• The Capacity Manager displays the total capacity of an application, including the network drives. If you loo
HP Storage Essentials SRM 6.0 User Guide 357The colors indicate that the element displayed in the following figure is about 75 percent available. The
Finding an Element’s Storage Capacity358NOTE: Capacity Manager provides additional tabs for NetApp NAS devices. The toolbars are the same.Table 51 Too
HP Storage Essentials SRM 6.0 User Guide 359Applications and hosts only: Lets you change the display frequency. The options are the following:• Hourly
Finding an Element’s Storage Capacity360Finding the Capacity of an ElementNOTE: Capacity Manager rounds the data it displays. As a result, the totals
HP Storage Essentials SRM 6.0 User Guide 361The following additional information is displayed for each storage group (Microsoft Exchange) or database
ivSigning in to HP SIM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24Enabling Product He
Overview2Storage Essentials, not in HP Systems Insight Manager. When you select Tools > Storage Essentials, you see a submenu listing several featu
Finding an Element’s Storage Capacity362• Volume Name• Aggregate Available• Aggregate Used• Volume Maximum• Volume Used• Percentage Volume UsedCapacit
HP Storage Essentials SRM 6.0 User Guide 363• Quota Soft Limit — The amount of disk space or the number of files that would have to be exceeded before
Finding an Element’s Storage Capacity364volumes have been allocated from those disk groups. For example, on CLARiiON storage systems these are disks t
HP Storage Essentials SRM 6.0 User Guide 365IMPORTANT: For arrays that permit RAID choice when creating volumes (for exaple the EVA), the concept of f
Finding an Element’s Storage Capacity366Obtaining Utilization ReportsThe software provides the following utilization reports to help you determine how
HP Storage Essentials SRM 6.0 User Guide 367To print the elements in Capacity Manager:1. Access Capacity Manager as described in ”Accessing Capacity M
Finding an Element’s Storage Capacity368NOTE: To change the orientation of the chart, hold down the mouse button when you click the chart, and continu
HP Storage Essentials SRM 6.0 User Guide 3699. Click the button to update the chart.10.To print the chart, click the button displayed in the same
Finding an Element’s Storage Capacity370The difference between the two calculations is the capacity reserved for superuser. If a file system has a res
HP Storage Essentials SRM 6.0 User Guide 37112 Managing PoliciesDepending on your license, Policy Manager may not be available. See the List of Featur
HP Storage Essentials SRM 6.0 User Guide 3To access the online help for Storage Essentials, access Storage Essentials, and click Help > For this pa
Managing Policies372• successful provisioning• the occurrance of an event on one or more specified elementsAccessing Policy ManagerThis section descri
HP Storage Essentials SRM 6.0 User Guide 373• Send E-mail - Policy Manager sends an e-mail when the condition is fulfilled. Enter a comma-separated li
Managing Policies374Manager so you receive an e-mail message when the amount of free space on a server decreases to a specified level.Keep in mind the
HP Storage Essentials SRM 6.0 User Guide 37515.To test a policy, click the Test button in the Utilization Policy table. The management server fires a
Managing Policies376Free Space TrendingA forecast of amount of free space on one of the following:• A host• A database instance, such as Microsoft SQL
HP Storage Essentials SRM 6.0 User Guide 377Creating Policies for DiscoveryYou can create an infrastructure policy that generates an event, sends an e
Managing Policies3781. Access Policy Manager as described in the topic, ”Accessing Policy Manager” on page 372.2. In the Policy Manager tree, expand t
HP Storage Essentials SRM 6.0 User Guide 3796. Select one or more element types.When a condition is fulfilled on a select element, Policy Manager gene
Managing Policies380IMPORTANT: Since the severity level for an element is set by the manufacture, the meanings of the severity levels vary. It is best
HP Storage Essentials SRM 6.0 User Guide 381• Modifying Utilization and Backup Policies, page 381• Modifying Discovery Policies, page 381• Modifying P
Overview4dependencies and view and manage your infrastructure as a whole. A SAN is a network configuration that is dedicated to transporting storage d
Managing Policies3827. Select Fire when event is cleared if you want the policy to act when the event is cleared. If you do not select "Fire when
HP Storage Essentials SRM 6.0 User Guide 383IMPORTANT: Specify shorter periods for important applications.7. Select or deselect one or more element ty
Managing Policies384Deactivating a PolicyPolicies are activated when they are created. You can deactivate a policy, but still keep it stored in the ma
HP Storage Essentials SRM 6.0 User Guide 385• First assign an SMTP server from which the management server can send its e-mail notifications. See ”Set
Managing Policies386Providing a Custom Command for a PolicyYou can configure Policy Manager to run a custom command on the management server when an e
HP Storage Essentials SRM 6.0 User Guide 38713 Viewing Performance Data Depending on your license, Performance Manager may not be available. See the L
Viewing Performance Data388Array Performance Pack RequirementsThe following paragraphs describe important requirements and considerations for licensin
HP Storage Essentials SRM 6.0 User Guide 389Command View version v7.01, or later, is highly recommended to take best advantage of the enhancements. Th
Viewing Performance Data390A screen similar to the following displays. Figure 89 Data Collector SelectionSelect the desired collectors from those list
HP Storage Essentials SRM 6.0 User Guide 391When licensed appropriately, you can review the collected data in Performance Manager. You can expand the
HP Storage Essentials SRM 6.0 User Guide 5Suggested Topics for First-Time UsersAs a first-time user, you should first become familiar with discovery a
Viewing Performance Data392For example, the following representative screen display shows information about data rates associated with the highlighted
HP Storage Essentials SRM 6.0 User Guide 393Command View EVA supports a standby configuration whereby an array can be managed by multiple Command View
Viewing Performance Data394• The minimum collection interval that can be set for the EVA performance data collectors is 1 minute. The collection inter
HP Storage Essentials SRM 6.0 User Guide 3952. Select the element you want to monitor.3. Under the Monitoring tab in the lower-left pane, select the e
Viewing Performance Data396Lets you determine the unit of measurement in the graph. Select one of the following options, and then click the button:•
HP Storage Essentials SRM 6.0 User Guide 397Lets you modify the performance data displayed in the graph and change graph settings. When you select it,
Viewing Performance Data398Comparing the Performance of Different ElementsUse Performance Manager to compare the performance of different elements. Le
HP Storage Essentials SRM 6.0 User Guide 399To view a summary chart:1. Access Performance Manager as described in ”Accessing Performance Manager” on p
Viewing Performance Data400NOTE: If there is not enough data to display, Performance Manager does not display the chart. For example, if you selected
HP Storage Essentials SRM 6.0 User Guide 4017. Click the calendar button to the right of the Start box.8. Enter the time in the time box. Make sure
Overview6network, so that the management server becomes aware of them. Then you must run Discovery Data Collection, so that the management server is a
Viewing Performance Data402Average IO Size (Bytes/Sec)LSI storage systems The average input/out size (bytes/sec)Buffer Cache Hits Count per SecondNAS
HP Storage Essentials SRM 6.0 User Guide 403Bytes Received(MB/Sec)• Storage systems• Host (port for HBA card)• NAS filer (IP port)• Switch portNumber
Viewing Performance Data404Disk Read (KB/second)Not available on HP-UX hosts because HP-UX hosts do not return read/write data separately.Disk drives
HP Storage Essentials SRM 6.0 User Guide 405File Read Percent Oracle Percentage of “reads” for the file against the total “reads” in the database.File
Viewing Performance Data406Inode Cache Misses Count per SecondNAS filers (system) The number of inode cache misses per second.Invalid CRC Errors (erro
HP Storage Essentials SRM 6.0 User Guide 407Name Cache Misses per SecondNAS filers The number of name cache misses per second on a NAS filer.Packets R
Viewing Performance Data408Physical Memory Used (%)Hosts The percentage of physical memory used on the host. To receive this data from a 64-bit AIX ho
HP Storage Essentials SRM 6.0 User Guide 409Redo Logspace Request RatioOracle The number of times lgwr had to wait for writing to redo the log file. I
Viewing Performance Data410Tablespace Read PercentOracle Percentage of “reads” for the tablespace against the total “reads” in the database.Tablespace
HP Storage Essentials SRM 6.0 User Guide 411Managing Late Data or ErrorsIf you are performing real time data collection, and the element is not return
HP Storage Essentials SRM 6.0 User Guide 7• The type of license you have. Depending on your license, all features may not be available. See the List o
Viewing Performance Data412• The management server only monitors the top or bottom layer of Solstice Disksuite/Volume Manager. For example, assume you
HP Storage Essentials SRM 6.0 User Guide 413Irix 6.5.x YIrix 6.5.x XVM YIrix 6.5.x CXFS Y (only on node sending I/O)Redhat 2.1 YRedhat 3.0 Sistina LV
Viewing Performance Data414Sudden Dips Displayed in Certain Charts in Performance ManagerIn Performance Manager and on the Monitoring tab, charts that
HP Storage Essentials SRM 6.0 User Guide 415The following charts for aggregate drives are impacted: ReadIOs, WriteIOs, TotalIOs, Bytes Transferred, Un
Viewing Performance Data416
HP Storage Essentials SRM 6.0 User Guide 41714 Running ReportsDepending on your license, Reporter may not be available. See the List of Features to de
Running Reports418• Excel - The software displays the report in Microsoft Excel, providing you have a copy of Microsoft Excel already installed.• XML
HP Storage Essentials SRM 6.0 User Guide 419• Backup Manager - Data about backups, such as reports about the status of the daily backup, backup volume
Running Reports420Global Reports/System/Storage SystemGlobal Storage System Details by VendorShows the capacity summaries for all storage systems roll
HP Storage Essentials SRM 6.0 User Guide 421Chargeback Manager Asset-Based ChargebackA monthly chargeback report, listed by subsystem, that shows cost
Overview8• Policy Manager — Policy Manager can automatically send an e-mail, generate an event, or run a remote script when an element is being overus
Running Reports422System/Events Event Summary by DateShows incomplete events by severity over time. Incomplete events are the events that are not clea
HP Storage Essentials SRM 6.0 User Guide 423System/File Server Top N Aged Files Shows the list of Top N aged files based on the file accessed time sta
Running Reports424System/File Server Top N Volumes with Stale FilesShows the top N Volumes with stale files for each file server. System/File Server
HP Storage Essentials SRM 6.0 User Guide 425System/Host Host Use of SAN Storage DetailsShows how external storage is being used by each host. System/H
Running Reports426System/Performance *EVA Storage Controller CPU UtilizationShows the CPU utilization for each controller. System/Performance *EVA Sto
HP Storage Essentials SRM 6.0 User Guide 427System/Performance *EVA Storage Pool ThroughputShows the throughput in MBs for the storage pool over time.
Running Reports428System/Storage System Storage Array Capacity by ApplicationsShows the capacity utilization by diiferent applications which have been
HP Storage Essentials SRM 6.0 User Guide 429System/Switch Total Switch Port UtilizationShows used and free ports across all fabrics and switches.Backu
Running Reports430Backup Manager Restore SLA Summary Shows the Restore backup SLA summary details over time. Backup Manager SLA Summary Shows the back
HP Storage Essentials SRM 6.0 User Guide 431Hosts/ Asset Summary Shows the detailed asset information for a host.Hosts Dependency Shows all applicatio
HP Storage Essentials SRM 6.0 User Guide 9• Discovery — This menu provides the tools for the management server to discover and obtain information from
Running Reports432NAS Details Shows the detailed configuration details of NAS storage. NAS Events Shows all non-cleared events received for the NAS st
HP Storage Essentials SRM 6.0 User Guide 433*You will need to purchase an Array Performance Pack license to be able to see these reports. See ”About P
Running Reports434• In File System Viewer reports, file extensions may sometimes be truncated in reports. For example myfilename.txt may appear as myf
HP Storage Essentials SRM 6.0 User Guide 435• Application Reports•Hosts Reports*•Storage System Reports*•Switch Reports**These reports display informa
Running Reports436• Excel - The software displays the report in Microsoft Excel, providing you have a copy of Microsoft Excel already installed.• XML
HP Storage Essentials SRM 6.0 User Guide 437yyyy-mm-dd hh:mm based on the 24-hour clock. There should be a space between the date and the time, as sho
Running Reports438• XML - Display the report in the XML format.Opening a Report in a New WindowUse this feature to view two or more reports simultaneo
HP Storage Essentials SRM 6.0 User Guide 439If you do not see information in your reports, verify that you have global reporting set up correctly. See
Running Reports4405. (Backup Manager reports only) Select the period of time you want displayed in the report by entering a start date and end date in
HP Storage Essentials SRM 6.0 User Guide 441To add an e-mail schedule:1. Access Reporter as described in ”Accessing Reporter” on page 435.2. Expand th
Overview10IMPORTANT: You may not see all of the following utilities, depending on the role assigned to your user account. For example, users assigned
Running Reports442• Monthly - If you select Monthly, select the time during the month you want the report sent:• To send the report on the first or la
HP Storage Essentials SRM 6.0 User Guide 443Editing an E-mail Schedule for a ReportIMPORTANT: Only the e-mail schedules created by the current user ar
Running Reports4443. When the report is displayed in the right pane, click the Scheduled Deliveries tab in the right pane.Information about the e-mail
HP Storage Essentials SRM 6.0 User Guide 445reports as you create them. Once you are satisfied with the customized reports, you can merge them onto th
Running Reports4461. Add the following class path to Report Designer. Refer to the documentation accompanying Report Designer for more information. C:
HP Storage Essentials SRM 6.0 User Guide 447If Report Designer cannot find the JDBC drivers, you may have entered incorrect path information.10.Select
Running Reports4483. Click the Standard Report icon and then click Create to start the Report Form Creation Wizard.Figure 95 Choosing a Standard Repor
HP Storage Essentials SRM 6.0 User Guide 449not want all data displayed in the report. To find a definition of the listings in a table, see ”Detailed
Running Reports450Refer to the online help for Report Designer for more information. When you finish selecting and linking materialized views, click N
HP Storage Essentials SRM 6.0 User Guide 4517. Enter search criteria that will be used to generate the report. For example, if you want the report to
HP Storage Essentials SRM 6.0 User Guide 11The Home PageThe Home page provides an overview of the main features for the management server. You can acc
Running Reports452the text in the AutoLabel column in the Report fields pane. To find a definition of the listings in a table, see ”Detailed Schema In
HP Storage Essentials SRM 6.0 User Guide 453For example, in the following figure, information in the report will first be sorted by an application nam
Running Reports45410.Use the Style tab to determine the layout of the report. When you are done, click Finish. Figure 101 Selecting the Layout of the
HP Storage Essentials SRM 6.0 User Guide 455The report template is displayed. You will not see any data reported, only placeholders, as shown in the f
Running Reports4565. Refer to the online help for Report Designer for information on how to design the report.Figure 103 Result of Clicking the View T
HP Storage Essentials SRM 6.0 User Guide 457The following screen displays.Figure 104 Manage Custom Reports ScreenThe screen lists these instructions t
Running Reports458After importing, a screen display similar to the following shows the imported report files. The imported reports can then be viewed
HP Storage Essentials SRM 6.0 User Guide 459report to the management server, and then you must integrate the report so that it is accessible from Repo
Running Reports460d. Make sure you use an ID that is not used by any of the existing reports. You must specify a title to appear in the tree and the f
HP Storage Essentials SRM 6.0 User Guide 461Table 60 Description of the Report ViewsMaterialized View(Tables)DescriptionMVC_ORGANIZATIONVW Provides in
HP Storage Essentials SRM 6.0 User Guide vObtaining SNMP Traps using Command View EVA . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56Com
Overview12You may not see all of these features, depending on the following:• The type of license you have. Depending on your license, all features ma
Running Reports462MVCA_DBAPPCAPACITYVW Provides capacity information for a supported database application. See Table 92 on page 485.MVCA_EXCHANGEAPPCA
HP Storage Essentials SRM 6.0 User Guide 463MVC_HOSTDISKDRIVEVW Provides information about host disk drives. See Table 64 on page 467.MVC_HOSTVOLUMESU
Running Reports464MVC_HOSTCAPACITYVW Provides host capacity information. See Table 78 on page 477.MVC_STORAGESYSTEMCONFIGVW Provides storage system co
HP Storage Essentials SRM 6.0 User Guide 465The following tables provide information about each report view:MVCA_FSRM_DIRREPORTDATAVW Provides informa
Running Reports466HOSTNAME VARCHAR2(256) Host NameDOMAINID NUMBER(38) DomainIDVENDOR VARCHAR2(256) Host VendorDESCRIPTION VARCHAR2(1024) Host Descript
HP Storage Essentials SRM 6.0 User Guide 467Model VARCHAR2(256) Card modelSerialNumber VARCHAR2(256) Card Serial NumberVersion VARCHAR2(256) Card Vers
Running Reports468DiskPartition VARCHAR2(256) Disk Partition NameDiskPartitionDescription VARCHAR2(1024) Description of the partitionDiskPartitionSPac
HP Storage Essentials SRM 6.0 User Guide 469StoragePoolDescription VARCHAR2(1024) Description of the storage poolStatus NUMBER(38) Operational status
Running Reports470Table 67 MVC_STORAGEVOLUMESUMMARYVWColumn Name Type DescriptionStorageVolumeID NUMBER(38) StorageVolume IDStorageVolumeName VARCHAR2
HP Storage Essentials SRM 6.0 User Guide 471Description VARCHAR2(1024) Description of the SwitchStatus NUMBER(38) Operational status (provide map here
HP Storage Essentials SRM 6.0 User Guide 13Installing the Java Plug-in Java 2 Runtime Environment is required to access several features in the manage
Running Reports472Table 69 MVC_PORTSUMMARYVWColumn Name Type DescriptionPortID NUMBER(38) Port IDPortName VARCHAR2(256) Port NameDomainID NUMBER(38) D
HP Storage Essentials SRM 6.0 User Guide 473DominaID NUMBER(38) Domain ID (currently only one domain)CimClassName VARCHAR2(28)Status NUMBER(38) AppIQ
Running Reports474ZoneMemberName VARCHAR2(254) Name of the zone memberZoneMemberType VARCHAR2(254) Type of the zone memberZoneMemberInFabric NUMBER(1)
HP Storage Essentials SRM 6.0 User Guide 475HBAPortID NUMBER(38) HBA Port IDHostSwitchPortID NUMBER(38) ID of Host Switch PortSystemSwitchPortID NUMBE
Running Reports476Time_Reported DateSeverity NUMBER(38)Cleared NUMBER(1)Source VARCHAR2(254)Type NUMBER(38)SubType NUMBER(38)Probable_Cause_Descriptio
HP Storage Essentials SRM 6.0 User Guide 477DOMAINID NUMBER(38) Domain IDTable 77 MVC_ORGRELATIONVW (continued)Column Name Type DescriptionTable 78 MV
Running Reports478Table 80 MVC_STORAGEPOOLCONFIGVWColumn Name Type DescriptionStoragePoolID NUMBER(38) Storage Pool IDCollectionTime TIMESTAMP (6) Con
HP Storage Essentials SRM 6.0 User Guide 479Table 83 MVC_DISKEXTENTSUMMARYVWColumn Name Type DescriptionDiskExtentID NUMBER(38) Disk Extent IDDiskEnxt
Running Reports480Table 85 MVC_VOLUMEDISKDRIVEVWColumn Name Type DescriptionVolumeID NUMBER(38) Storage Volume IDDiskDriveID NUMBER(38) Disk Drive IDE
HP Storage Essentials SRM 6.0 User Guide 481Table 87 MVC_DISKDRIVESUMMARYVWColumn Name Type DescriptionDiskDriveID NUMBER(38) Disk Drive IDDiskDriveNa
Overview14Installing the Software Security CertificateTo stop receiving a Security Alert message each time you use the HTTPS logon, install the softwa
Running Reports482ContainerExtentID NUMBER Container Extent IDDiskID NUMBER Disk Drive IDTable 88 MVC_DISK_EXTENTVW (continued)Column Name Type Descri
HP Storage Essentials SRM 6.0 User Guide 483STORAGETIERCOSTPERGB NUMBER(36,2) Asset storage Tier costDEPARTMENTNO VARCHAR2(255) Asset department noD
Running Reports484 RESELLER VARCHAR2(255) Asset Reseller COMMENTS VARCHAR2(4000) Comments ASSETFIXCOSTTAXPERDEPTPERYEAR NUMBER Asset Fixed cost tax
HP Storage Essentials SRM 6.0 User Guide 485Application Core ViewsTable 91 MVC_UNITACCESSVWColumn Name Type DescriptionID NUMBER(38)STORAGE_VOLUME_ID
Running Reports486Table 93 MVCA_EXCHAPPCAPACITYVWColumn Name Type DescriptionExchangeAppID NUMBER(38)HostID NUMBER(38)CapacityType Varchar2(7)Timestam
HP Storage Essentials SRM 6.0 User Guide 487TotalDirectories NUMBER(38)TotalFiles NUMBER(38)DomainID NUMBER(38)Timestamp Timestamp(6)Table 95 MVCA_FSR
Running Reports488ParentKey NUMBER(38)DirName Varchar2(254)DirLSevel NUMBER(38)DirSize NUMBER(38)TotalSubDirectories NUMBER(38)TotalFiles NUMBER(38)Vo
HP Storage Essentials SRM 6.0 User Guide 489Contact Varchar2(254)Department Varchar2(254)Email Varchar2(254)Quota NUMBER(38)DomainID NUMBER(38)Table 1
Running Reports490Table 103 MVCA_BU_MASTERSERVERSUMMARYColumn Name Type DescriptionMasterServerID NUMBER(38)MasterServerName Varchar2(256)HostID NUMBE
HP Storage Essentials SRM 6.0 User Guide 491Table 105 MVCA_BU_CLIENTSUMMARYColumn Name Type DescriptionClientID NUMBER(38)ClientName Varchar2(256)Mast
HP Storage Essentials SRM 6.0 User Guide 15Installing the Certificate by Using Firefox 1.51. Access the management server by entering the following:ht
Running Reports492Created DateAssigned DateLastMounted DateFisrtMounted DateExpirationDate DateNumberOfMounths NUMBERMaxMountsAllocated NUMBERDensity
HP Storage Essentials SRM 6.0 User Guide 493MasterServerID NUMBERClientID NUMBERBUJobID NUMBERJobState Varchar2(16)JobStatus Varchar2(16)ScheduleName
Running Reports494Type Varchar2(64)RobotType Varchar2(64)RobotNumber NUMBERTotalNoOfSlots NUMBERTotalSlotsInUse NUMBERTotalNumberOfDrives NUMBERRobotD
HP Storage Essentials SRM 6.0 User Guide 495Table 111 MVC_DISCOVERYDETAILSVWName DescriptionElementID ID of the quarientiend elementElementName Name o
Running Reports496ObjectType Object typeTable 113 MVC_APPLICATIONRELATIONVWName DescriptionApplicationClusterID ID of the cluster applicationApplicati
HP Storage Essentials SRM 6.0 User Guide 497Storagetype Type of storage Table 115 MVCA_BU_OPTIONALTABLEVWName DescriptionBasetableid ID of the basetab
Running Reports498ServerName Name of Exchange serverStoreID Store ID of the mailboxMailboxMessageSizeBytes Messages sizeUserMailBoxSizebytes Mailbox s
HP Storage Essentials SRM 6.0 User Guide 499CountofContacts Count of contacts in the mailboxCountofMessages Count of messagesAssociated_content_count
Running Reports500ApplicationID Application IDTable 121 MVCA_FSRM_FILEREPORTDATAVWName DescriptionVolumeid ID of FSRM volumeVolumename Name of volumeR
HP Storage Essentials SRM 6.0 User Guide 501Filename Name of the fileTotalsize Total size of fileAccesstime Timestamp of access timeCreatetime Timesta
Overview16IMPORTANT: The quotes in the example must be entered as left single quotes.2. Go to the following directory:<Install_Dir>/Toolswhere I
Running Reports502Freephysicalmemory Percentage of physical memory freePercentvirtualused Percentage of virtual memory usedFreevirtualmemory Percentag
HP Storage Essentials SRM 6.0 User Guide 503CPUPERCENTDATAXFERPERCENTDELTAREADIOSDELTAREADLATENCYDELTAWRITEIOSDELTAWRITELATENCYPCTREADIOSPCTWRITEIOSRE
Running Reports504AVGWRITESIZEDELTADRIVELATENCYDELTAREADIOSDELTAREADLATENCYDELTATOTALIOSDELTAWRITEIOSDELTAWRITELATENCYPCTREADIOSPCTWRITEIOSREADDATARAT
HP Storage Essentials SRM 6.0 User Guide 505DELTAREADIOSDELTAREADLATENCYDELTAWRITEIOSDELTAWRITELATENCYDISCARDFRAMESLINKFAILURELOSSOFSIGNALLOSSOFSYNCHP
Running Reports506AVGREADMISSLATENCYAVGREADSIZEAVGWRITELATENCYAVGWRITESIZEDELTAREADHITIOSDELTAREADHITLATENCYDELTAREADMISSIOSDELTAREADMISSLATENCYDELTAW
HP Storage Essentials SRM 6.0 User Guide 507Table 130 MVCS_EVASTORAGESYSTEMSTATSVWName DescriptionIDCOLLECTIONTIMESTATSTYPEDEVICETIMEDURATIONTOTALDATA
Running Reports508Views from Previous ReleasesIn this release, the materialized views were renamed, revised and in some cases removed. The following v
HP Storage Essentials SRM 6.0 User Guide 509correctly against these new views. Some of the views have changed and may not work in existing reports. T
Running Reports510MV_LUNSPERFASUMMARYVW MVC_STORAGESYSTEMCONFIGVWMVC_STORAGESYSTEMSUMMARYVWMVC_STORAGEPROCESSORSUMMARYVWMVC_PORTSUMMARYVWMVC_PORTCONTR
HP Storage Essentials SRM 6.0 User Guide 511MV_TEMPHOSTLOGICALVW MVC_HOSTDISKDRIVEVWMVC_SUBPATHVWMVC_PATHVWMVC_HOSTVOLUMESUMMARYVWMVC_HOSTSUMMARYVWMVC
HP Storage Essentials SRM 6.0 User Guide 17IMPORTANT: Linux management servers require a fixed IP address for starting the appstormanager service.1. O
Running Reports512MV_HOSTVXVMVW MVC_DISKEXTENTSUMMARYVWMVC_HOSTSUMMARYVWMVC_DISK_EXTENTVWMVC_DISKDRIVESUMMARYVWMVC_OPTIONALTABLEVW, MVC_PATHVWMVC_SUBP
HP Storage Essentials SRM 6.0 User Guide 513MV_HOSTSSDEPENDECYVW MVC_HOSTSUMMARYVWMVC_SUBPATHVWMVC_STORAGEVOLUMESUMMARYVWMVC_STORAGESYSTEMSUMMARYVWMVC
Running Reports514MV_TEMPCONNECTEDSTORAGEVW MVC_PORTSUMMARYVWMVC_STORAGEPROCESSORSUMMARYVWMVC_STORAGESYSTEMSUMMARYVWMVC_SWITCHSUMMARYVWMVC_HOSTSUMMARY
HP Storage Essentials SRM 6.0 User Guide 515MV_DBAPPCHARGEBACKVW MVC_APPLICATIONSUMMARYVWMVCA_DBAPPINSTCAPACITYVWMVCA_DBAPPPHYCAPACITYVWMVCA_EXCHAPPCA
Running Reports516
HP Storage Essentials SRM 6.0 User Guide 51715 Provisioning ManagerDepending on your license, Provisioning Manager may not be available. See the List
Provisioning Manager518About Provisioning Brocade Switches After UpgradingAfter you upgrade the management server, perform Discovery Data Collection f
HP Storage Essentials SRM 6.0 User Guide 519some network administrators prefer to put all of the Microsoft Windows computers in one zone and all of th
Provisioning Manager520Finance can access storage systems B and C but not storage system A. Likewise, users in Production can access storage systems A
HP Storage Essentials SRM 6.0 User Guide 521Use Table 133 on page 521 as a guideline for setting up zoning. Keep in mind the following:• If you use an
Overview18
Provisioning Manager5221The ability to create, modify, and remove zone aliases, zones, and zone sets.2Also applies to EMC Connectrix switches.3Also ap
HP Storage Essentials SRM 6.0 User Guide 523• If a zone alias for a Sun StorEdge or QLogic switch is a member of an active zone, the zone alias is not
Provisioning Manager5242. In the right pane, click the SAN Zoning tab.3. Click the Provision button for the fabric on which you want to do provisionin
HP Storage Essentials SRM 6.0 User Guide 525Zone Naming ConventionsThe following naming conventions apply to zones, zone sets, and zone aliases:Naming
Provisioning Manager526NOTE: To select all of the ports, select the check box next to the Port heading. 7. Click OK.Deleting a Zone AliasYou cannot de
HP Storage Essentials SRM 6.0 User Guide 527Qlogic1:zone_name displayed under the Name column. Qlogic1 is the name of the switch, and zone_name is the
Provisioning Manager528• You cannot create a zone with an existing name. • A port is not in the virtual SAN if the icon is next to it. 10.Click OK.A
HP Storage Essentials SRM 6.0 User Guide 529• For more information about which zoning features are supported for your switches, see Table 134 on page
Provisioning Manager5301. Click Tools > Storage Essentials > Provisioning Manager in HP Systems Insight Manager.2. In the right pane, click the
HP Storage Essentials SRM 6.0 User Guide 5318. Click OK.Deleting a Zone SetThe software does not display all elements in a zone set, such as quick loo
HP Storage Essentials SRM 6.0 User Guide 192 Discovering Switches, StorageSystems, NAS Devices, and Tape LibrariesBefore you can use the management se
Provisioning Manager532IMPORTANT: This feature is supported only for switches that support zone set copying. Refer to Table 134 on page 521 for inform
HP Storage Essentials SRM 6.0 User Guide 533b. Optional: In the Name box, modify the name that has been assigned to the backup zone set. The managemen
Provisioning Manager534If a user activates ZoneSetB, the existing information in ZoneSetB is copied to the switch and activated. The Zoning Library, h
HP Storage Essentials SRM 6.0 User Guide 5351. Select Options > Storage Essentials > Manage Product Health, and then click Advanced in the Disk
Provisioning Manager536Managing StorageThis section contains the following topics:• Setting Up Storage Partitioning, page 536• Modifying the Cache Set
HP Storage Essentials SRM 6.0 User Guide 5371The “Create Pool Using Settings” column refers to the functionality that lets you choose the type of pool
Provisioning Manager538CLARiiON Y Y Y Y RAID level can be specified for first volume in a pool, subsequent volumes inherit this setting.LSI and Sun 61
HP Storage Essentials SRM 6.0 User Guide 539HP MSA Y N N YIBM DSY N N Y See ”Additional Information About IBM DSS and IBM ESS” on page 540IBM ESS Y N
Provisioning Manager540Additional Information About CLARiiON Storage SystemsThe EMC Navisphere® CLI is required to communicate with the CLARiiON stora
HP Storage Essentials SRM 6.0 User Guide 541• Issues Specific to LSI Storage Systems, page 569How to Set Up Storage PartitioningTo set up storage part
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries20About DiscoveryWhen HP Storage Essentials is integrated with HP SIM, Discovery
Provisioning Manager5421. Click the Edit ( ) button for the volume you want to modify. 2. Enter the cache read ahead multiplier (0 to 65535 bytes) in
HP Storage Essentials SRM 6.0 User Guide 543Creating a Storage Pool (LSI, CLARiiON, Sun 6130 and Sun 35xx)A storage pool is a group of disks associate
Provisioning Manager544•Volumes - Click the name of the volume to view its properties. If the storage system has a large number of volumes, not all th
HP Storage Essentials SRM 6.0 User Guide 545• Creating a Storage Volume, page 547• Deleting a Storage Volume, page 550• Changing the Cache Block Size
Provisioning Manager546To create a volume, click the New Volume button in the upper-right corner of the page. To delete several volumes at once, selec
HP Storage Essentials SRM 6.0 User Guide 547to the storage system until the volume is mapped to a port. As a result, they are referred to as Groups. F
Provisioning Manager548operations. So if you want to create a LUSE volume and then perform LUN creation on the HDS box, it is a two-step process. Firs
HP Storage Essentials SRM 6.0 User Guide 549NOTE: You can also access the Create Storage Volume wizard from the Navigation tab in System Manager. To a
Provisioning Manager550• Database - Provides a cache read ahead multiplier of 0 with a segment size of 64 KB.• Multimedia - Provides a cache read ahea
HP Storage Essentials SRM 6.0 User Guide 5517. When you are asked if you want to delete the volume, click OK.8. To delete several storage volumes at o
HP Storage Essentials SRM 6.0 User Guide 21Note the following:• Storage systems managed by HP Storage Essentials show a subtype of Storage Essentials
Provisioning Manager55211.Click OK.Rules for Creating Host Security GroupsThis section contains the following topics:• ”Host Security Groups on EMC CL
HP Storage Essentials SRM 6.0 User Guide 553NOTE: For the Volume Creation and LUN Security option in Path Provisioning, the All Ports node is not show
Provisioning Manager554• When creating a host security group, if you provide a volume, but not an initiator, the host security group is created, but t
HP Storage Essentials SRM 6.0 User Guide 555Host Security Groups on HP MSA Storage SystemsKeep in mind the following rules for host security groups on
Provisioning Manager556• The management server can read the names of host security groups created by the native tool.• Creation of a new host security
HP Storage Essentials SRM 6.0 User Guide 5572. In the right pane, click the Storage Systems tab. 3. Click the Provision button for the storage system
Provisioning Manager558• - Move back one page.• - Move forward one page. • - Move to the last page.You can also create, edit and delete host securi
HP Storage Essentials SRM 6.0 User Guide 559NOTE: You cannot name a host security group on IBM storage systems. The host security group will be given
Provisioning Manager5605. To remove an initiator from the host security group, click the Delete ( ) button. To remove multiple HBA initiators from the
HP Storage Essentials SRM 6.0 User Guide 561NOTE: Each type of storage system handles ports for host security groups differently. For more information
viViewing the Status of System Tasks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 75Using Discovery Groups .
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries224. A host containing a Host Bus Adapter (HBA). All Fibre Channel host bus adap
Provisioning Manager562• If you want to choose a unit number, deselect the Auto-Select option and enter the unit number in the Unit Number box at the
HP Storage Essentials SRM 6.0 User Guide 5632. Click Show Default Properties at the bottom of the page.3. Copy smi.ProvisioningIbmEss.hostConnectionPr
Provisioning Manager564Issues Specific to CLARiiON Storage SystemsThe following issues are specific to CLARiiON® storage systems:• Making the Manageme
HP Storage Essentials SRM 6.0 User Guide 565About Provisioning on EMC Symmetrix Storage SystemsEMC ships its Symmetrix storage system with volumes alr
Provisioning Manager566Issues Specific to HDS Storage SystemsThis section contains the following topics:• About Provisioning on HDS Storage Systems, p
HP Storage Essentials SRM 6.0 User Guide 567In build 5.0, the management server uses the nickname attribute when it’s available. If you want to update
Provisioning Manager568group, but the target host security group is deleted when the first command is completed, and the second command returns an err
HP Storage Essentials SRM 6.0 User Guide 569Cannot Always Delete Selected Volume on MSAMSA volumes must be deleted in the reverse order of their creat
Provisioning Manager570NOTE: No volume-to-LUN masking is done by default.IMPORTANT: The management server creates a placeholder volume when a storage
HP Storage Essentials SRM 6.0 User Guide 57116 Managing BackupsDepending on your license, the Backup Manager feature may not be available. See the Lis
HP Storage Essentials SRM 6.0 User Guide 23example, in the phased discovery described in ”Discovering Elements” on page 27, you could discover your sw
Managing Backups572• Media Manager Application — A backup application functioning as a server to control the media in a backup hierarchy. A media mana
HP Storage Essentials SRM 6.0 User Guide 573IMPORTANT: Make sure you have at least 500 MB available if you are using the host as a backup manager host
Managing Backups574• Allocated — The media is currently either actively being used or has a valid backup on it.• Frozen — The media will never become
HP Storage Essentials SRM 6.0 User Guide 575• Session Status — The session status: Success or Failure• Session State — The session state: Done, Queued
Managing Backups5761. Access Backup Manager by clicking Tools > Storage Essentials > Backup Manager or by clicking Tools > Storage Essentials
HP Storage Essentials SRM 6.0 User Guide 577period for the coverage and review the policy, schedule, and results for the backups executed for that per
Managing Backups578To access the backup reports:1. Access Reporter by clicking Reports > Storage Essentials > Manage Reports or clicking Tools &
HP Storage Essentials SRM 6.0 User Guide 579About the Toolbars in Backup Manager Backup Manager has two toolbars.• The main toolbar that appears at th
Managing Backups580Allows you to move an element in the topology. See ”Arranging Elements in the Topology” on page 274. Enabled when the Topology tab
HP Storage Essentials SRM 6.0 User Guide 581About the Toolbar for ChartsThe toolbar options described in Table 140 on page 581 are only available when
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries24Configuring the HP SIM Connector to Pass Devices with the DNS Name (Optional)B
Managing Backups582Changing the Topology Settings The Display Layout Settings Dialog ( ) button allows you to modify the following properties of the t
HP Storage Essentials SRM 6.0 User Guide 5832. Click Export to Visio.3. Name the file, and then select the directory in which you want the file to be
Managing Backups584Update Element Data The management server gathers new and changed details from the element and then redraws the topology with the u
HP Storage Essentials SRM 6.0 User Guide 585The charts in Backup Manager provide a wealth of information about your backups. You can obtain detailed i
Managing Backups586Table 143 on page 586 explains what is displayed when you click Show Details on the Summary tab’s right-click menu option.NOTE: Whe
HP Storage Essentials SRM 6.0 User Guide 587About the Summary Backup Charts Backup Manager displays six summary backup charts on the Summary tab by de
Managing Backups588About the Tabs in the Topology Lower Pane The lower pane on the Topology tab is displayed when you select a discovered backup eleme
HP Storage Essentials SRM 6.0 User Guide 589Table 146 Tabs in the Lower Pane of Backup Manager Topology Tab Element Type DescriptionProperties All el
Managing Backups590Resources • Backup Manager Hosts• Media Managers• Tape LibrariesDisplays the resources Backup Manager monitors with the following f
HP Storage Essentials SRM 6.0 User Guide 591Sorting Information in the Lower PaneYou can sort the information displayed on the tabs in the lower pane
HP Storage Essentials SRM 6.0 User Guide 25• Do not run the initial discovery process at the end of the wizard. See the HP Systems Insight Manager Use
Managing Backups592can be extremely useful. For example, if you have several clients with failed backups, you would take the following steps to sort t
HP Storage Essentials SRM 6.0 User Guide 593To modify a chart displayed on the Summary tab in Backup Manager:1. Access Backup Manager as described in
Managing Backups5941. Access a backup summary chart by clicking an element on the Topology tab. 2. Scroll to the bottom of the screen.3. Click the Pri
HP Storage Essentials SRM 6.0 User Guide 59517 Path ProvisioningDepending on your license, Path Provisioning may not be available. See the List of Fea
Path Provisioning596• Changes from executed jobs. After a job is executed in Path Provisioning, the Path Provisioning screen is not updated until you
HP Storage Essentials SRM 6.0 User Guide 597• Only manageable fabrics will be displayed in the Path Provisioning. If no provisioning can be done on th
Path Provisioning598The status of each job is displayed in the State column of the Provision Job section located in the lower pane of the screen. A jo
HP Storage Essentials SRM 6.0 User Guide 599NOTE: You can control which templates users can access. See ”Assigning a Template to a Role” on page 636 f
Path Provisioning600Default System Action TemplatesThis section describes the contents of the default system action templates and the options included
HP Storage Essentials SRM 6.0 User Guide 601• If you have options still selected from a previous job, clear the options you do not want in your next j
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries26The Discovery Setup, Step 1 - Setup page shows the HP Storage Essentials manag
Path Provisioning602The selected storage system’s name is displayed below the Storage System pane. The Host pane is populated. Notice in the figure be
HP Storage Essentials SRM 6.0 User Guide 603• Loading zone data finished.The Step 2 button is disabled until data has been loaded2. Select a host that
Path Provisioning604key on your keyboard and selecting free LDEVS. When you select free extents, they must of the same type. For example, on Symmetrix
HP Storage Essentials SRM 6.0 User Guide 605• To create a zone - Select a fabric in the zone pane, click the button, and then enter a name for the z
Path Provisioning606• To clear the action taken in all Steps except Step 1, select another option from the System Action combo-box.• HDS only: Before
HP Storage Essentials SRM 6.0 User Guide 607When you first discover a storage system, no free extents are displayed. This is because the management se
Path Provisioning6082. Select the storage system on which you want to create the metavolume.NOTE: The S column heading in the Storage Systems pane mea
HP Storage Essentials SRM 6.0 User Guide 609• If you select hosts and storage ports that are not contained in an existing zone alias, the new hosts an
Path Provisioning610IMPORTANT: Make sure the added host is physically connected to the network before the scheduled job runs.1. Click the button.2.
HP Storage Essentials SRM 6.0 User Guide 611Keep in mind the following:• You can narrow the type of volumes displayed in the Volumes pane by using the
HP Storage Essentials SRM 6.0 User Guide 27e. In the WBEM settings section, select Update values for this protocol and Use values specified below. f.
Path Provisioning612NOTE: The S column heading in the Storage Systems pane means that only a single selection is allowed.3. Click the Step 1 button be
HP Storage Essentials SRM 6.0 User Guide 6131. Wait for all data to be loaded. When all data has been loaded, the following messages are displayed.:•
Path Provisioning614Step 3 - Select a ZoneNOTE: If the zone has already been selected and Step 5 is clicked, skip this step or click the button to c
HP Storage Essentials SRM 6.0 User Guide 615• If you want the job to execute now, click the Execute Job () button• If you want the job to execute at a
Path Provisioning616The selected storage system’s name is displayed below the Storage System pane.Figure 112 Selecting a Storage SystemStep 2 - Select
HP Storage Essentials SRM 6.0 User Guide 617type. For example, on Symmetrix, you cannot select a mirrored volume and a BCV (business continuous volume
Path Provisioning618• If you have options still selected from a previous job, clear the options you do not want in your next job. For example, assume
HP Storage Essentials SRM 6.0 User Guide 619The selected storage system’s name is displayed below the Storage System pane. The Host pane is populated.
Path Provisioning620The Step 2 button is disabled until data has been loaded2. Take one of the following actions:• Select a host that is accessible.•
HP Storage Essentials SRM 6.0 User Guide 6215. Repeat Steps 2 and 3 for multiple ports.6. If you want to remove the host, click the button.7. When y
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries28IMPORTANT: For best results, enter only global credentials that apply to the s
Path Provisioning622IMPORTANT: (McDATA switches only) Path Provisioning looks for the names of the active zone set and of the active zones and verifie
HP Storage Essentials SRM 6.0 User Guide 623You can assign a volume to existing host security groups, as described in the following steps.1. Click Too
Path Provisioning624Step 2 - Select a VolumeTo select a volume:1. In the Volume pane select mapped and unmapped volumes. You can select multiple volum
HP Storage Essentials SRM 6.0 User Guide 625Step 3 - Select a Host Security Group1. Select a host security group in the LUN pane. See ”Creating a Host
Path Provisioning6262. In the right pane, click Start Here on the Path Provisioning tab.3. Click the Configure Templates button at the top of the scre
HP Storage Essentials SRM 6.0 User Guide 6276. Click Apply.7. When you are done, take one of the following actions:•Click Apply if you want to apply y
Path Provisioning6283. Select a host in the Host pane.4. Click Step 2.5. Select a port in the LUN pane.6. Click at the top of the LUN pane.7. When y
HP Storage Essentials SRM 6.0 User Guide 629To schedule a provisioning job:1. Click the Create Job button in the lower pane.The job is assigned the “c
Path Provisioning630Executing Provisioning JobsIf you want to save and execute a job, you must click the Execute Job ( ) button. When you click that b
HP Storage Essentials SRM 6.0 User Guide 631• The name is case sensitive. For example, “Zone1” and “zone1” are different zones.• You cannot create a z
HP Storage Essentials SRM 6.0 User Guide 2911.Select the discovery task created in step 4, and then click Run Now.When complete, the task monitor show
Path Provisioning632To narrow the types of volumes displayed in the Volume pan, set the Customize Volume Options dialog box. The Customize Volume Opti
HP Storage Essentials SRM 6.0 User Guide 633Customize Volume Options Dialog BoxNOTE: The Customize Volume Options dialog box is not available for the
Path Provisioning634identical zone contains only the same HBA and storage system ports you selected. If the zone contains additional members, it is no
HP Storage Essentials SRM 6.0 User Guide 6354. Select a storage system, and click Step 1. 5. Select a host, and click Step 2. One of the following occ
Path Provisioning636Assigning a Template to a RoleYou can assign templates to a role to restrict a user’s access to all templates. For example, you co
HP Storage Essentials SRM 6.0 User Guide 63718 Chargeback ManagerDepending on your license, Chargeback Manager may not be available. See the List of F
Chargeback Manager638First set up your chargeback as described in the topic, ”Setting Up Chargeback Manager” on page 638. When you are done with addin
HP Storage Essentials SRM 6.0 User Guide 639Accessing Chargeback ManagerTo access Chargeback Manager, do one of the following:•Select Tools > Stora
Chargeback Manager640the management server cannot obtain detailed information about the element. If you create a record for an application, that appli
HP Storage Essentials SRM 6.0 User Guide 641• In Use - The element is running.The status settings are set manually. For example, if the status of an e
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries30Discovery process. For more information on switch support, see the support mat
Chargeback Manager6421. To remove an asset record, click the Delete ( ) button corresponding to the record you want to remove. Defining Storage TiersT
HP Storage Essentials SRM 6.0 User Guide 643Creating a New Storage TierYou can create you own storage tiers (up to a maximum of 64).Follow these steps
Chargeback Manager644Removing Elements from a Storage TierFollow these steps to remove elements from a storage tier:1. Access the Add or Remove Storag
HP Storage Essentials SRM 6.0 User Guide 645Adding Asset InformationChargeback Manager provides a handy way for you to keep track of your asset inform
Chargeback Manager646NOTE: This page enforces the maximum number of characters you can enter in a box. When you can no longer add additional character
HP Storage Essentials SRM 6.0 User Guide 647• Staff #2 Name - The name of an additional person who maintains the element.• Staff #2 Phone Number - A p
Chargeback Manager648Managing DepartmentsThis section contains the following topics:• Adding Departments, page 648• Editing a Department, page 648• Re
HP Storage Essentials SRM 6.0 User Guide 649For example, assume you want to delete a department called TooSmall. The TooSmall department owns 50 perce
Chargeback Manager650• Setting Up Asset-Based Chargeback Manager, page 650• Setting Up Storage-Based Chargeback Manager, page 653• Editing Percentage
HP Storage Essentials SRM 6.0 User Guide 651Step 1 - Specify Financial information1. Verify that the option Step 1 - Specify Financial information is
HP Storage Essentials SRM 6.0 User Guide 31periodically to verify that you are running a current version of the Brocade SMI Agent. For more informatio
Chargeback Manager6521. Select the option Step 2 - Assign Departmental Ownership Percentage at the top of the page.2. Click Add Ownership. 3. Select a
HP Storage Essentials SRM 6.0 User Guide 653IMPORTANT: The infrastructure cost is not included in ownership cost because the information displayed on
Chargeback Manager654NOTE: You can also access the tree from Application Viewer and System Manager.• To access the tree from Application Viewer, click
HP Storage Essentials SRM 6.0 User Guide 655Step 3 - Review Storage Dependency and CostIMPORTANT: The management server displays chargeback informatio
Chargeback Manager6566. In the Ownership % box, enter a new percentage of ownership. 7. Click Save Changes. Removing Department Ownership of an Elemen
HP Storage Essentials SRM 6.0 User Guide 657MB to gigabytes (0.887 GB) and round the output (0.89 GB), the capacity in Capacity Manager matches the nu
Chargeback Manager658Example: Using the examples from the previous two steps, the delta is 12 months (January 1, 2003 through December 31, 2003).4. It
HP Storage Essentials SRM 6.0 User Guide 6593. The management server takes the user-specified depreciation period and use it as the life of the asset.
Chargeback Manager660Step 5a - Assume the asset value of the element is $2395. Calculate the "would-be" depreciation of the month by multipl
HP Storage Essentials SRM 6.0 User Guide 661Example: Use the example from step 4 (24 months) in the following formula to find the rate of depreciation
HP Storage Essentials SRM 6.0 User Guide viiStep A — Import the Wrapper Class Definitions into the Caché Instance . . . . . . . . . . . . . 115Step
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries32This document is written for an earlier version of the Brocade SMI Agent, but
Chargeback Manager662Step 6b - Assume the salvage value is $100. Determine if the asset value after depreciation is less than the salvage value by usi
HP Storage Essentials SRM 6.0 User Guide 663Viewing Chargeback by Department You can determine how much a department is being charged for equipment us
Chargeback Manager664Viewing Chargeback by Owner You can view chargeback for all elements by using the Ownership tab. The Ownership tab shows the owne
HP Storage Essentials SRM 6.0 User Guide 665Chargeback ReportsThis section contains the following topics:• Viewing Chargeback Reports, page 665• E-mai
Chargeback Manager6664. To view the report in a new window, select the Open in new window option, and then click Run Report. E-mailing a Chargeback Re
HP Storage Essentials SRM 6.0 User Guide 667• Viewing the History of an E-mail Chargeback Schedule, page 671Adding an E-mail Schedule for a Chargeback
Chargeback Manager668If you are e-mailing reports in bulk, you might want to let users know the e-mail is being sent by an automated process. You migh
HP Storage Essentials SRM 6.0 User Guide 669Editing an E-mail Schedule for a Chargeback Report IMPORTANT: Only the e-mail schedules created by the cur
Chargeback Manager670Deleting E-mail Schedules for a Chargeback ReportIMPORTANT: Only the e-mail schedules created by the current user are listed. To
HP Storage Essentials SRM 6.0 User Guide 671Information about the e-mail schedules for that report are displayed, as described in Table 156 on page 67
HP Storage Essentials SRM 6.0 User Guide 335. Run Discovery Data Collection. See the chapter, “Discovering Switches, Storage Systems, NAS Devices, and
Chargeback Manager6724. When the report is displayed in the right pane, click the Scheduled Deliveries tab in the right pane.5. Under the History colu
HP Storage Essentials SRM 6.0 User Guide 673ready for your changes to take effect. Chargeback Manager displays only the elements you specified in your
Chargeback Manager674ready for your changes to take effect. Chargeback Manager displays only the elements you specified in your filter.Customizing the
HP Storage Essentials SRM 6.0 User Guide 67519 Business ToolsDepending on your license, Business Tools may not be available. See the List of Features
Business Tools676Only Discovery Data Collection removes elements that are no longer there from the user interface. For example, removed ports could ap
HP Storage Essentials SRM 6.0 User Guide 677Installing New HBA with Old HBATo install the new HBA with the old HBA:1. Install the new HBA with the old
Business Tools678Let's expand that analysis to verifying that those HBA's also have a certain driver version and a certain firmware level, a
HP Storage Essentials SRM 6.0 User Guide 679• 1002 is the element ID.Comparing a Previous Configuration by Using Global Change ManagementNOTE: Global
Business Tools680it is done, it lists the changes under the heading CHANGED PROPERTIES on the screen.The following sample output displays the analyzed
HP Storage Essentials SRM 6.0 User Guide 681Host _1750...Host _1739...Switch clbrocade3...Host _1732...Host COLO-WINHOST2...Host _1717...StorageSystem
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries34•If you selected No in the Brocade SMI Agent Enabling Security window, you can
Business Tools682 NEW DiskPartition Disk #6, Partition #2 NEW DiskDrive 6005076303ffc640000000000000110f:c0t1d4p4 NEW DiskDrive 6
HP Storage Essentials SRM 6.0 User Guide 683 NEW LogicalDisk M: NEW HostTargetMapping_1025 NEW HostTargetMapping_1042 NEW
Business Tools684
HP Storage Essentials SRM 6.0 User Guide 68520 TroubleshootingHP Storage Essentials Standard Edition supports a subset of the devices supported by Ent
Troubleshooting686• Increasing the time-out for the HP SIM Connector, page 689• Storage Essentials Menus Are Not Shown in HP SIM, page 690• NoSuchElem
HP Storage Essentials SRM 6.0 User Guide 687Checking Installation Log Files • The following log files are generated by the installer and can be found
Troubleshooting688“SEVERE: OUI-10029...” MessageThe installation wizard lets you specify an installation location for Oracle 10g. If you specify a loc
HP Storage Essentials SRM 6.0 User Guide 6891. Enter the following at the command prompt, where mycomputer is the shortened DNS name of the machine:ns
Troubleshooting690<admin-user>management-server-domain\administrator</admin-user> <SIM-on-windows>true</SIM-on-windows>
HP Storage Essentials SRM 6.0 User Guide 691IMPORTANT: Do not install the Oracle database separately, the management server Installation Wizard (or Un
HP Storage Essentials SRM 6.0 User Guide 35b. Make the following entry in the file:cimomenabled=TRUEc. Save the file, and then restart the InVsn softw
Troubleshooting6921. Stop the AppStorManager service, which is the service the management server uses.NOTE: While the service is stopped, the manageme
HP Storage Essentials SRM 6.0 User Guide 693Unix systemsTo verify the Oracle service has started, enter the following at the command prompt:# ps -ef |
Troubleshooting694Permanently Changing the Port a CIM Extension Uses (UNIX Only)CIM extensions on UNIX use port 4673 by default. You can start a CIM e
HP Storage Essentials SRM 6.0 User Guide 695• The “If Mentioned in cim.extension.parameters” column provides information on how you would modify the c
Troubleshooting696With 3 firewall ports opened on different ports respectively 1234, 5678, 9012.start -on 10.250.250.10:1234-on 172.31.250.10: 5678-on
HP Storage Essentials SRM 6.0 User Guide 697With firewall port 1234 opened between a host and management server. NAT environment where 10.250.250.10
Troubleshooting698Volume Names from Ambiguous Automounts Are Not DisplayedVolume names from ambiguous automounts on Solaris hosts are not displayed on
HP Storage Essentials SRM 6.0 User Guide 699The following example is a comma-separated string that is part of a mounted volume name. The management se
Troubleshooting700The security certificate has a valid name matching the name of the page you are trying to view.When you change the certificate, you
HP Storage Essentials SRM 6.0 User Guide 701NOTE: If you see an error message when you enter this command, a previous certificate may not have been cr
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries36• Enable the CIM Server for Cisco switches discovered through the SMI-S provid
Troubleshooting702• A Discovered Sun StorEdge A5000 JBOD Does Not Display Its WWN Properly, page 714• Unable to Monitor McDATA Switches, page 714• Una
HP Storage Essentials SRM 6.0 User Guide 703• HBA (Driver Version)• MultipathingUnable to discover Emulex host bus adaptersThe Emulex driver does not
Troubleshooting704The status reports for Discovery Data Collection are sent as follows:• gaedemail property is empty - The e-mail is sent to users who
HP Storage Essentials SRM 6.0 User Guide 7058. To modify the time-out period, set the corresponding property for your switch in the following table to
Troubleshooting706“Connection to the Database Server Failed” ErrorIf you received an error message resembling the following after getting all element
HP Storage Essentials SRM 6.0 User Guide 707Duplicate Listings/Logs for Brocade Switches in Same FabricDuplicate listings: Targets tabIf you discover
Troubleshooting708Element Logs Authentication Errors During DiscoveryDuring discovery, you may see SNMP authentication errors on the element you are t
HP Storage Essentials SRM 6.0 User Guide 709set a TNS listener password, the software is not able to discover the Oracle instances serviced by the lis
Troubleshooting710• Unable to Detect a Host Bus Adapter, page 714• Navigation Tab Displays Removed Drives as Disk Drives, page 715• Unable to Obtain I
HP Storage Essentials SRM 6.0 User Guide 711Host appears discovered and it is not connected to the switch.The switch was previously made aware of the
HP Storage Essentials SRM 6.0 User Guide 37• HP SIM does not allow blank passwords. Since these switches do not use a password, enter anything for the
Troubleshooting712*The CIM extension for Microsoft Windows enhances Windows Management Instrumentation (WMI) so that it can gather information from ho
HP Storage Essentials SRM 6.0 User Guide 7138. Enter the host’s WWN in hexadecimal format. Multiple WWNs can be entered as a comma-separated list. For
Troubleshooting714A Discovered Sun StorEdge A5000 JBOD Does Not Display Its WWN ProperlyAlthough full monitoring and management support is available o
HP Storage Essentials SRM 6.0 User Guide 715Navigation Tab Displays Removed Drives as Disk DrivesIf you remove an internal disk from a Solaris host an
Troubleshooting7169. When you are done, click Save.“CIM_ERR_FAILED” MessageIf you are in a McDATA environment where the EFC Manager Service Processor
HP Storage Essentials SRM 6.0 User Guide 717the loss of communication, perform Discovery Data Collection to obtain the latest information from the ele
Troubleshooting718Once the connection is working, the provisioning operation should succeed. If it continues to fail because the active zone set infor
HP Storage Essentials SRM 6.0 User Guide 719still increase the time before the management server times out, but keep in mind that it will lengthen dis
Troubleshooting720During the recalculation period, you may not be able to log into the application. If you are already logged into the application, na
HP Storage Essentials SRM 6.0 User Guide 721See ”Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries” on page 19 for more informati
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries38• For switches with SMI-S connections, provide the switch user name. • HP SIM
Troubleshooting722• Known Driver Issues, page 722• Known Device Issues, page 722• “mailbox command 17 failure status FFF7” Message, page 725• ”Process
HP Storage Essentials SRM 6.0 User Guide 723Table 162 Known Device IssuesDevice Software DescriptionAIX host NA If you are receiving replication error
Troubleshooting724SGI IRIX host CXFS file systemsThe management server can only monitor CXFS file systems from the host generating the input/output. F
HP Storage Essentials SRM 6.0 User Guide 725Solaris host VxVM If you discover a host with any typical SAN disk groups off line, the storage volume pag
Troubleshooting726“mailbox command 17 failure status FFF7” MessageIf one or more of your Microsoft Windows hosts are using an Emulex HBA driver, you m
HP Storage Essentials SRM 6.0 User Guide 727If a provisioning failure has caused the Symmetrix storage system to remain locked, you are alerted to thi
Troubleshooting728
HP Storage Essentials SRM 6.0 User Guide 729GlossaryAaccess point It is the intersection of the IP address and the provider that discovered the IP add
730services such as event notification, remote access, and query processing. The CIM Object Manager also grants access to the CIM Object Manager repos
HP Storage Essentials SRM 6.0 User Guide 731scan files very quickly because of its structure in the database and because it uses a multi-threaded proc
HP Storage Essentials SRM 6.0 User Guide 39Keep in mind the following:• SMI-S is the default method for discovering McDATA and Connectrix switches. If
732mapped Mapped is capacity that is accessible by one or more hosts external to the array (aggregated capacity of volumes that are accessible from ho
HP Storage Essentials SRM 6.0 User Guide 733such as disk mirroring, RAID 5, backup/restore, and data migration, as well as being able to incorporate N
734Instrumentation (WMI) Microsoft created WMI as its implementation of Web-based Enterprise Management (WBEM). For more information about WMI, refer
HP Storage Essentials SRM 6.0 User Guide 735Index3PAR 48AaboutAccess tab 258asset attributes 323Backup Manager toolbar 579Business Tools 675butto
736domain controller 88, 126elements 151, 153e-mail schedule 440event policies 379general information 645geographic information 647host securi
HP Storage Essentials SRM 6.0 User Guide 737resources 588scheduling collectors 198servers 588summary backup charts 575, 587, 592topology 582Bac
738full name 146logging 192login name 146number of retries 704Oracle Listener Password 243organizations 153password 126, 146phone number 146p
HP Storage Essentials SRM 6.0 User Guide 739cimom.symmetrix.exclude 49CIO role 137CISCO switchestopology 251VSAN 251Cisco switches 35CLARiiON 53
740cumulative licenses 172Current View combo box 357customperiods 400custom commandsabout 293adding 294deleting 296editing 296setting up 265st
HP Storage Essentials SRM 6.0 User Guide 741roles 150storage pool 544storage pools 543TNS Listener Port 126user accounts 146volumes 550, 564zon
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries40http://www.hp.com/go/hpsim/providers for instructions. Check this web site per
742credentials 22discovery groups 76discovery list 77element changes 81elements 21, 27Emulex host bus adapters 703enabling product health monit
HP Storage Essentials SRM 6.0 User Guide 743discovery schedule 184e-mail address 146e-mail schedule 443e-mail schedules 206, 669fabric name 265,
744EMC Symmetrix 49, 536, 564excluding from forced refresh 50Empty Chart message 367Emulex host bus adapters 703errordatabase connection failed
HP Storage Essentials SRM 6.0 User Guide 745host dependency 632LUN dependency 633storage system dependency 632volume dependency 632, 633zone depe
746hierarchyorganizations 137hostnot in topology 709host bus adapterunable to detect 714host bust adaptersreplacing 676host dependencyhost 632hos
HP Storage Essentials SRM 6.0 User Guide 747Java memory 691increasing memory 691Java plug-in 720installing 13jboss.propertiesmodifying 187jobspro
748Bridge Agent 38changing the discovery settings 43discovering 38excluding from discovery 44managing 45adding 46removing 46replacing 46member
HP Storage Essentials SRM 6.0 User Guide 749namingstorage tier 642naming conventionsfor zones 630naming organizations 137NAS devicesdiscovery 63HP
750Volume Creation, LUN Security, and Zone Operation 600, 625volume dependency filter 632, 633zone dependency filter 633Zone Operation 611Path t
HP Storage Essentials SRM 6.0 User Guide 751drivers 722processexclusive lock 726Processor Utilization 401product health monitoringenabling 25profi
HP Storage Essentials SRM 6.0 User Guide 41NOTE: The user name and password are defined during the SMI-S provider installation. These credentials migh
752schedules 205storage pool 544storage pools 543TNS Listener Port 126user accounts 146volumes 550zone aliases 526zone members 528zone sets 5
HP Storage Essentials SRM 6.0 User Guide 753SSAN xxxv, 732SAN Zoning Overview 518savingchargeback information 641graph 395graphs 394logs 190top
754cache block 569storage pool 543SMI-S devicesdiscovery 20testing SMI-S providers 23SMTP 178, 733SNIA specification 733SNMPauthentication erro
HP Storage Essentials SRM 6.0 User Guide 755Sun NAS devices 66Sun StorEdge A5000 714Sun StorEdge storage systems 61, 623510 626130 626920, 6940
756timesetting 223timeoutHDS 566TNS Listener Portchanging 126tnsnames.ora file 214toolbarBackup Manager 579Capacity Manager 357System Manager 2
HP Storage Essentials SRM 6.0 User Guide 757user profilemodifying 146usersabout 137adding 144first time 5organizations 148roles 147, 148, 149u
758Worldwide Name 734WorldWide Name zoning 733Worldwide Name zoning 734about 734write caching 541Write Operations 401WWN 734XXFS 326Xiotech st
viiiManaging Roles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 148Adding Roles
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries42• User name—Enter the user name for EFC Manager or Connectrix Manager.• Passwo
HP Storage Essentials SRM 6.0 User Guide 43NOTE: The management server uses the Windows SNMP trap service when you run HP SIM and HP Storage Essential
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries44To enable SNMP:a. Uncomment the cimom.useSnmpMcDataProvider property by removi
HP Storage Essentials SRM 6.0 User Guide 45The management server excludes the switches with the following WWNs: 1000080088A07024 and 1000080088A0D0B6I
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries46Adding McDATA and EMC Connectrix SwitchesAfter you add switches to an existing
HP Storage Essentials SRM 6.0 User Guide 474. Click Close to return to the Advanced page.5. Paste the copied text into the Custom Properties box. 6. M
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries48Discovering 3PAR Storage SystemsTo discover a 3PAR storage system, the SMI-S s
HP Storage Essentials SRM 6.0 User Guide 49• Password of the storage system.Discovering EMC Solutions EnablerIf you are using a nethost file, edit it
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries50If the cimom.symmetrix.exclude property is not specified, the management serve
HP Storage Essentials SRM 6.0 User Guide 511. Select Options >Storage Essentials > Manage Product Health > Advanced. 2. Click Show Default Pr
HP Storage Essentials SRM 6.0 User Guide ixCustomizing Properties . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries52When you use the management server to discover the CLARiiON storage system, pr
HP Storage Essentials SRM 6.0 User Guide 53To obtain information about HDS storage systems, the management server must be able to access the port that
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries543. Copy the following command. #cimom.hds.exclude=61038,610374. Click Close to
HP Storage Essentials SRM 6.0 User Guide 55NOTE: To find the serial number, double-click the storage system in System Manager, and then click the Prop
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries56• Password for accessing the MSA SMI-S provider Discovering HP StorageWorks EV
HP Storage Essentials SRM 6.0 User Guide 57Indications for display in its Event Manager. HP Storage Essentials then forwards the events to HP SIM&apos
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries58Viewing or Changing the Community String in Command View EVA 6.xTo view or cha
HP Storage Essentials SRM 6.0 User Guide 59NOTE: To determine provisioning support for HP StorageWorks Arrays, see Table 135 on page 536 and Table 136
Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries60NOTE: The user name and password must be for a Partition Storage Administrator
HP Storage Essentials SRM 6.0 User Guide 61•For DS devices enter cmd addessserver <ipaddress> <username> <password> where ipaddress
Kommentare zu diesen Handbüchern